(data stored in ACNUC7421 zone)

EMBL: CP001700.PE43

CP001700.PE43        Location/Qualifiers
FT   CDS             45132..45386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0043"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sma:SAV_4331 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68998"
FT                   /db_xref="GOA:C7QFQ9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU68998.1"
FT                   /translation="MPESKVRKKAAYTPPPDKKQPIKLDTGNRVVLPLMVGCFVLGLLW
FT                   IVIYYLSNMTYPVSALHGWNMAVGFGLIITGFIASMRWK"
     MPESKVRKKA AYTPPPDKKQ PIKLDTGNRV VLPLMVGCFV LGLLWIVIYY LSNMTYPVSA        60
     LHGWNMAVGF GLIITGFIAS MRWK                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page