(data stored in ACNUC7421 zone)

EMBL: CP001700.PE430

CP001700.PE430       Location/Qualifiers
FT   CDS             482489..482917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69385"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVM9"
FT                   /inference="similar to AA sequence:KEGG:gll3649"
FT                   /protein_id="ACU69385.1"
FT                   /translation="MDVVGEALPAIISAVRTYGDTVLTAGEQAAASGTVSLGRRLLQKL
FT                   FGGAPKPVVFEDAVANLAAAPESDDAVAALRLQIGNVLARHPELRDEIAAMLPHQTGNT
FT                   VSGDGSANAGRDQNISASGGTAVGVLNIHPSSPDPTTR"
     MDVVGEALPA IISAVRTYGD TVLTAGEQAA ASGTVSLGRR LLQKLFGGAP KPVVFEDAVA        60
     NLAAAPESDD AVAALRLQIG NVLARHPELR DEIAAMLPHQ TGNTVSGDGS ANAGRDQNIS       120
     ASGGTAVGVL NIHPSSPDPT TR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page