(data stored in ACNUC7421 zone)

EMBL: CP001700.PE431

CP001700.PE431       Location/Qualifiers
FT   CDS             483007..485148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0434"
FT                   /product="putative ATP/GTP binding protein"
FT                   /note="KEGG: fra:Francci3_0876 putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69386"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN0"
FT                   /inference="similar to AA sequence:KEGG:Francci3_0876"
FT                   /protein_id="ACU69386.1"
FT                   /translation="MAAAFTATGVPQVQVLFGLGGVGKTSVAVEYAYRFADSYGIVWQF
FT                   SAEHPESLDGQIGELAAHLGLLVPPTTDDAAGSLRSHLVNADRPWLLVLDNVVDDAVVH
FT                   RLVPAAGPGHVVVTSQRATWPGRARVREVPVLDRDVAIKYLLSAADSSDVAASGLLVDA
FT                   LGGLPLALAHAAAFLRVTGRPVQFYLDKLSAMLVRPGRGKAVARTWSAAIGQLGSAGSP
FT                   AMALLRVLACFAPDAIPVRLLFPDDAPVPEGLSADVADQLAALADDGLAVDDALIALRE
FT                   FSLVGSPVGDGVVSIHRLVQAATLEAMSPEEQSAWRQAATALVVRATPDDPNLPETWPA
FT                   FTALLRHIEQVVPAEHDCYLRAADHLGAVGNYRAAVAMARRSLEARARRQGPDAPETLA
FT                   ARQSTAQWTGHAGDFEGARDQCADLLPIRERLLGVEHPDTLSTRSVLAFWTARAGSYAA
FT                   ARNQGIDLLSIRERVLGIEHPDTLLTRSNLAGWTGNAGDPAGARDQFADLLPRYQHVLG
FT                   DEHPVTLITRTHLARWVGEAGDPAGARDRFADVLPIRERVFGAEHPDTLHVRANLARWT
FT                   GKAGAAAEARDQYAVLLPLFERVLGPEHPATLTNRRNLAHWTGKAGDAHGAREQLVALL
FT                   PLHQRVLGPEHVSTLHARHNLARWTKNAGDNAGARDQFTDLLPIRERVLGSEHLDTVKT
FT                   RNGLASCITETERVPGATE"
     MAAAFTATGV PQVQVLFGLG GVGKTSVAVE YAYRFADSYG IVWQFSAEHP ESLDGQIGEL        60
     AAHLGLLVPP TTDDAAGSLR SHLVNADRPW LLVLDNVVDD AVVHRLVPAA GPGHVVVTSQ       120
     RATWPGRARV REVPVLDRDV AIKYLLSAAD SSDVAASGLL VDALGGLPLA LAHAAAFLRV       180
     TGRPVQFYLD KLSAMLVRPG RGKAVARTWS AAIGQLGSAG SPAMALLRVL ACFAPDAIPV       240
     RLLFPDDAPV PEGLSADVAD QLAALADDGL AVDDALIALR EFSLVGSPVG DGVVSIHRLV       300
     QAATLEAMSP EEQSAWRQAA TALVVRATPD DPNLPETWPA FTALLRHIEQ VVPAEHDCYL       360
     RAADHLGAVG NYRAAVAMAR RSLEARARRQ GPDAPETLAA RQSTAQWTGH AGDFEGARDQ       420
     CADLLPIRER LLGVEHPDTL STRSVLAFWT ARAGSYAAAR NQGIDLLSIR ERVLGIEHPD       480
     TLLTRSNLAG WTGNAGDPAG ARDQFADLLP RYQHVLGDEH PVTLITRTHL ARWVGEAGDP       540
     AGARDRFADV LPIRERVFGA EHPDTLHVRA NLARWTGKAG AAAEARDQYA VLLPLFERVL       600
     GPEHPATLTN RRNLAHWTGK AGDAHGAREQ LVALLPLHQR VLGPEHVSTL HARHNLARWT       660
     KNAGDNAGAR DQFTDLLPIR ERVLGSEHLD TVKTRNGLAS CITETERVPG ATE              713
//

If you have problems or comments...

PBIL Back to PBIL home page