(data stored in ACNUC7421 zone)

EMBL: CP001700.PE433

CP001700.PE433       Location/Qualifiers
FT   CDS             485889..487886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69388"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69388.1"
FT                   /translation="MALAQLPNPGGPHLIAQAERSAVAVLAPEAPPEPGAEPALCLIGS
FT                   GFFITTDLVLTCAHVVADEPELYVLSGSVTLRVKAVELIDPPYDGDDSWPVPDLALLRI
FT                   EPAPPDDESDPYPVWLDLAPNASFISSAGYLSVGYDKRGPGGAAALASRLYDAGGTRKA
FT                   NAPGLPSFTYVELAGNTVPTYRSGSMVIDLSTGRVTGIVKAARAEDDGDGGYAVPLAGV
FT                   LPRVLSRQLGVQKAKDILAAHDSFHARTVDWPAMCEHYFTGPQPPGAIRADSTKLPLNE
FT                   VALLGLLVSIRHVVTDAELFEIIQSHSGLELAADAGLRDVALGLAATTTWSSTDVHSLL
FT                   RFMDGLTTRLEHRVSQQWLAEARKWADGLAAKLNQTSRLRALRMQTSAIRRTSGAAEAG
FT                   SSSLRVLVDPAFDPAGGYHVSIRMHHSAGVGAEQSPEETIGSASVLAHLRDVLPAAVRA
FT                   AARLDGGCLIDLVLPLDLLAEPVHKWEVSGSTPLGHLLPVAVRSVERYRDRDDVPGARL
FT                   REIWDRASKEAVSLQWIMCEDPENTGRAVEHTGLGLVNPPTSRHRRSRRLLDEAVQDGV
FT                   PLLVWSASDCGVDHADPQNVSVLCAGPYFQGIAEEALRDVVLEDVPHRLFAKRSQAGAE
FT                   ELDAVALFWDNPGLGHEENLLTEPCYPEDS"
     MALAQLPNPG GPHLIAQAER SAVAVLAPEA PPEPGAEPAL CLIGSGFFIT TDLVLTCAHV        60
     VADEPELYVL SGSVTLRVKA VELIDPPYDG DDSWPVPDLA LLRIEPAPPD DESDPYPVWL       120
     DLAPNASFIS SAGYLSVGYD KRGPGGAAAL ASRLYDAGGT RKANAPGLPS FTYVELAGNT       180
     VPTYRSGSMV IDLSTGRVTG IVKAARAEDD GDGGYAVPLA GVLPRVLSRQ LGVQKAKDIL       240
     AAHDSFHART VDWPAMCEHY FTGPQPPGAI RADSTKLPLN EVALLGLLVS IRHVVTDAEL       300
     FEIIQSHSGL ELAADAGLRD VALGLAATTT WSSTDVHSLL RFMDGLTTRL EHRVSQQWLA       360
     EARKWADGLA AKLNQTSRLR ALRMQTSAIR RTSGAAEAGS SSLRVLVDPA FDPAGGYHVS       420
     IRMHHSAGVG AEQSPEETIG SASVLAHLRD VLPAAVRAAA RLDGGCLIDL VLPLDLLAEP       480
     VHKWEVSGST PLGHLLPVAV RSVERYRDRD DVPGARLREI WDRASKEAVS LQWIMCEDPE       540
     NTGRAVEHTG LGLVNPPTSR HRRSRRLLDE AVQDGVPLLV WSASDCGVDH ADPQNVSVLC       600
     AGPYFQGIAE EALRDVVLED VPHRLFAKRS QAGAEELDAV ALFWDNPGLG HEENLLTEPC       660
     YPEDS                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page