(data stored in ACNUC7421 zone)

EMBL: CP001700.PE434

CP001700.PE434       Location/Qualifiers
FT   CDS             487888..488886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0437"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: sco:SCO2449 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69389"
FT                   /db_xref="GOA:C7PVN3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN3"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACU69389.1"
FT                   /translation="MKDWWIFKGEGVPHRRVEQLPPPMASRSFGGAPLVELTLEEDRAA
FT                   VARLGRSEAEQRLLLSEPDLDLINAAILLRRPLLVTGKPGSGKSSLAYAIARELSLGPV
FT                   LHWSITSRTGVKEGLYGYDALGRLEETNLRRIMGADTAPDLGEYIRLGPLGTALLPQKH
FT                   PRVLLIDELDKSDLDLPNDLLHVFENGEFEIEEVVRQRGTDSVEVGVTGQPTPVTVHGG
FT                   LVRCNAFPIVVLTDNGERDFSAAFLRRCVRLKLADPDRDRLVGIVEAHLGEEGVRTGRT
FT                   LIEDFLVKRRAGTVATDQLLGAVYLAIAAKLGGTDRAELADRIMAPLDQVG"
     MKDWWIFKGE GVPHRRVEQL PPPMASRSFG GAPLVELTLE EDRAAVARLG RSEAEQRLLL        60
     SEPDLDLINA AILLRRPLLV TGKPGSGKSS LAYAIARELS LGPVLHWSIT SRTGVKEGLY       120
     GYDALGRLEE TNLRRIMGAD TAPDLGEYIR LGPLGTALLP QKHPRVLLID ELDKSDLDLP       180
     NDLLHVFENG EFEIEEVVRQ RGTDSVEVGV TGQPTPVTVH GGLVRCNAFP IVVLTDNGER       240
     DFSAAFLRRC VRLKLADPDR DRLVGIVEAH LGEEGVRTGR TLIEDFLVKR RAGTVATDQL       300
     LGAVYLAIAA KLGGTDRAEL ADRIMAPLDQ VG                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page