(data stored in ACNUC7421 zone)

EMBL: CP001700.PE435

CP001700.PE435       Location/Qualifiers
FT   CDS             488883..491351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69390.1"
FT                   /translation="MTRIVPDDARAALADFIEAVAPAELSAEEIAEALWLAQWINQSAG
FT                   ATAGSAEPQQESGQEAPPPHRVPVSIPRTPAGRQQPARAHPPATVADAESEPERRTSPP
FT                   PRLMGSALIRVPSPTGSEAVRFARSLRRLRPLPVRRAPGTADAAATVDEAETARFAAET
FT                   GLLWPVYTRQRPRRGVAKVVVDTSVSMQVWEGLEEDIVRGLSLSRVFRRVETWSLYQRG
FT                   ETAVVCERRAGVAAGHEGPLARLADGSGDGAVLILSDGVARLWYDGAVLDAVDRLAVQG
FT                   PVALVQPLPNRLWRRTGLRPRLTTVTGTARGPEALHLTRVAIGTAAPAVPIIEADESWF
FT                   ATWAALASGRLATARFAVLGSRSPAGYAQSVAAGGVQEPGQLVGDGMAVPVVRRFRAAA
FT                   SQGARELAAALSVVPLSLPIMQMVLATCFPDRSRAHLAEVITGGLMQRDPKVPEGGGPP
FT                   AFRWLPGVGEELRREVDDRQAERVRAALSGYLDAELGFRPDSRGFIAIMGTPAMPAERE
FT                   GRFGSPFARILPDTVRRALNHAGVAYTVSDTVGTASEAQRITHALALAEAARNTGRSAE
FT                   IDEAIEAARLAVSEAAGRDWPLTDALAELLEHRGRREGSPFDAEEAVIVLREYVDRAPA
FT                   DDPHRQEGLERLADALLARYQSTESPDDLDDAIRMRRRLAEAEDAAQDQLVLLADALLE
FT                   HHRLTGASLSAYEATDLMSGLRRTGQSEGVRVAATAILARGLDIMSRSTRAEEDIEASD
FT                   AVWLALMPELGELTEDQAAVTRTAIEARIRFHKSSGRAGRARALEAAYEDALGRLGQQW
FT                   GLPGAQASAI"
     MTRIVPDDAR AALADFIEAV APAELSAEEI AEALWLAQWI NQSAGATAGS AEPQQESGQE        60
     APPPHRVPVS IPRTPAGRQQ PARAHPPATV ADAESEPERR TSPPPRLMGS ALIRVPSPTG       120
     SEAVRFARSL RRLRPLPVRR APGTADAAAT VDEAETARFA AETGLLWPVY TRQRPRRGVA       180
     KVVVDTSVSM QVWEGLEEDI VRGLSLSRVF RRVETWSLYQ RGETAVVCER RAGVAAGHEG       240
     PLARLADGSG DGAVLILSDG VARLWYDGAV LDAVDRLAVQ GPVALVQPLP NRLWRRTGLR       300
     PRLTTVTGTA RGPEALHLTR VAIGTAAPAV PIIEADESWF ATWAALASGR LATARFAVLG       360
     SRSPAGYAQS VAAGGVQEPG QLVGDGMAVP VVRRFRAAAS QGARELAAAL SVVPLSLPIM       420
     QMVLATCFPD RSRAHLAEVI TGGLMQRDPK VPEGGGPPAF RWLPGVGEEL RREVDDRQAE       480
     RVRAALSGYL DAELGFRPDS RGFIAIMGTP AMPAEREGRF GSPFARILPD TVRRALNHAG       540
     VAYTVSDTVG TASEAQRITH ALALAEAARN TGRSAEIDEA IEAARLAVSE AAGRDWPLTD       600
     ALAELLEHRG RREGSPFDAE EAVIVLREYV DRAPADDPHR QEGLERLADA LLARYQSTES       660
     PDDLDDAIRM RRRLAEAEDA AQDQLVLLAD ALLEHHRLTG ASLSAYEATD LMSGLRRTGQ       720
     SEGVRVAATA ILARGLDIMS RSTRAEEDIE ASDAVWLALM PELGELTEDQ AAVTRTAIEA       780
     RIRFHKSSGR AGRARALEAA YEDALGRLGQ QWGLPGAQAS AI                          822
//

If you have problems or comments...

PBIL Back to PBIL home page