(data stored in ACNUC7421 zone)

EMBL: CP001700.PE437

CP001700.PE437       Location/Qualifiers
FT   CDS             491790..492959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0440"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   fre:Franean1_5726 radical SAM domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69392"
FT                   /db_xref="GOA:C7PX41"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX41"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69392.1"
FT                   /translation="MSLDTGAGLPRPARAGWTATGLRQFVLKLHSRCNLACSYCYIYEG
FT                   PDQSWRDKPGTMSPETIALTASRIAEHVATHRPPWIEVVLHGGEPLMAGLPVLRNAAET
FT                   IRAAVPDTTAVRLIVQTNGLLLTEQMLEGLDALGILVAVSIDGSASDNDRRRRFRDGRG
FT                   SFDAVSTGLRMLTSERFRHLFVGFLCVIDLESDPLAVYEALTVWDPPTVDLLLPHRTWA
FT                   DPPPPGARYAAWLSEVFDHWYRSGSATGIRVFDEIIAVLLGARTGTTAIGAGPVQHVTV
FT                   ETDGSLEADDILKIAYAGAPETGLTLARHSFDDYLATPALMDRRSGIDALCRECRECPI
FT                   VGVCGGGTYPHRFRPGHGFANPSAYCHDLMAVISHIKEAIIGDLSGRPA"
     MSLDTGAGLP RPARAGWTAT GLRQFVLKLH SRCNLACSYC YIYEGPDQSW RDKPGTMSPE        60
     TIALTASRIA EHVATHRPPW IEVVLHGGEP LMAGLPVLRN AAETIRAAVP DTTAVRLIVQ       120
     TNGLLLTEQM LEGLDALGIL VAVSIDGSAS DNDRRRRFRD GRGSFDAVST GLRMLTSERF       180
     RHLFVGFLCV IDLESDPLAV YEALTVWDPP TVDLLLPHRT WADPPPPGAR YAAWLSEVFD       240
     HWYRSGSATG IRVFDEIIAV LLGARTGTTA IGAGPVQHVT VETDGSLEAD DILKIAYAGA       300
     PETGLTLARH SFDDYLATPA LMDRRSGIDA LCRECRECPI VGVCGGGTYP HRFRPGHGFA       360
     NPSAYCHDLM AVISHIKEAI IGDLSGRPA                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page