(data stored in ACNUC7421 zone)

EMBL: CP001700.PE438

CP001700.PE438       Location/Qualifiers
FT   CDS             493087..496119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5712 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69393"
FT                   /db_xref="GOA:C7PX42"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX42"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69393.1"
FT                   /translation="MVLHSAIPGVRDALVVHCDADETWVSWIDEALADQGFQTHRLSWT
FT                   ADGEDLGRTIGDVLGGGVSCCVVVLSEAFLAAADYSPQQWRTALRDSADLLDRLFPVVV
FT                   DRAQLPAELPLEVRQQIIDISDVGEQAARERLIQAVSGEPPVGRVPVRTREGKVRTRFP
FT                   ASDPAIWCPWTPNRNFSFVGRDKELKALHARLWDAPRGQARVAVTGLGGVGKSQIAVEY
FT                   MYRYQSEYDAVWFVRATRTAIARQDVVNVGAELGAPSADDLQAGIDGALRALLEDARTR
FT                   RWLVVIDDARSAAAVKDLLPSFPGQHGHVIITSTDENWTDIAAELPIQPMSAEESFRYL
FT                   RSRLPETGDEDLQALVGYCDGLPIAMDLAAAQVRGAAQSVRAFLQSASERGVDQYQVKL
FT                   GRHEKTVAQTYLTALDSVGREVPAAGELLRLLSFMASAPIPIRLFGALSQDSGLPELAD
FT                   LAQVSRGFADSSALLGMLSEIRKHSLATIGLQGEESVISMHRVPQRVIVADIAEDQALR
FT                   YRHAVHLMLRARDIGAARTSAQWLVMLEIWRNLESSDGWDCELCAADISCRQMMLHVIR
FT                   ALMIWSESTQCEAAAARAIAAWTPVLGPHHTDVREATLERANALRNMGRAGEALELDEA
FT                   LARDVAEMPDVRPAIAIRTGLNRGGDLRRLGRFADASTIDTQTRDRAVDEFGEIDRLSL
FT                   MARGNVSVSYLLLGEAANAMRNDEDLVRDQVRLRGDGDRAAFQTRTRIARAHRDMGQYR
FT                   SAVEMQEHNTYRCERVFGPHDATTLTAKGTLASCLRKAGQYEEARRVASTTVTDLQKLI
FT                   GDRHPEMVLAMTELANCLVRTDRRADAAELGRQALMLAVEVCGTDHPFTAICQNNLALV
FT                   HLVQHEPFEAETLLNEAAQVFAALPTDHPHQLIVAANLATALWDRGEYTKAEDLEKQLE
FT                   PKFVQALGENHPTTLAVASNRVTTFDALAGDDATRRTINNARWRRTVAAYQRVLTREHP
FT                   DVQIAEERRRRIHIALDAPAV"
     MVLHSAIPGV RDALVVHCDA DETWVSWIDE ALADQGFQTH RLSWTADGED LGRTIGDVLG        60
     GGVSCCVVVL SEAFLAAADY SPQQWRTALR DSADLLDRLF PVVVDRAQLP AELPLEVRQQ       120
     IIDISDVGEQ AARERLIQAV SGEPPVGRVP VRTREGKVRT RFPASDPAIW CPWTPNRNFS       180
     FVGRDKELKA LHARLWDAPR GQARVAVTGL GGVGKSQIAV EYMYRYQSEY DAVWFVRATR       240
     TAIARQDVVN VGAELGAPSA DDLQAGIDGA LRALLEDART RRWLVVIDDA RSAAAVKDLL       300
     PSFPGQHGHV IITSTDENWT DIAAELPIQP MSAEESFRYL RSRLPETGDE DLQALVGYCD       360
     GLPIAMDLAA AQVRGAAQSV RAFLQSASER GVDQYQVKLG RHEKTVAQTY LTALDSVGRE       420
     VPAAGELLRL LSFMASAPIP IRLFGALSQD SGLPELADLA QVSRGFADSS ALLGMLSEIR       480
     KHSLATIGLQ GEESVISMHR VPQRVIVADI AEDQALRYRH AVHLMLRARD IGAARTSAQW       540
     LVMLEIWRNL ESSDGWDCEL CAADISCRQM MLHVIRALMI WSESTQCEAA AARAIAAWTP       600
     VLGPHHTDVR EATLERANAL RNMGRAGEAL ELDEALARDV AEMPDVRPAI AIRTGLNRGG       660
     DLRRLGRFAD ASTIDTQTRD RAVDEFGEID RLSLMARGNV SVSYLLLGEA ANAMRNDEDL       720
     VRDQVRLRGD GDRAAFQTRT RIARAHRDMG QYRSAVEMQE HNTYRCERVF GPHDATTLTA       780
     KGTLASCLRK AGQYEEARRV ASTTVTDLQK LIGDRHPEMV LAMTELANCL VRTDRRADAA       840
     ELGRQALMLA VEVCGTDHPF TAICQNNLAL VHLVQHEPFE AETLLNEAAQ VFAALPTDHP       900
     HQLIVAANLA TALWDRGEYT KAEDLEKQLE PKFVQALGEN HPTTLAVASN RVTTFDALAG       960
     DDATRRTINN ARWRRTVAAY QRVLTREHPD VQIAEERRRR IHIALDAPAV                 1010
//

If you have problems or comments...

PBIL Back to PBIL home page