(data stored in ACNUC7421 zone)

EMBL: CP001700.PE439

CP001700.PE439       Location/Qualifiers
FT   CDS             496241..497434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_7062t hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69394"
FT                   /db_xref="GOA:C7PX43"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX43"
FT                   /inference="similar to AA sequence:KEGG:SGR_7062t"
FT                   /protein_id="ACU69394.1"
FT                   /translation="MGQDSQNSDSLGRRRAPALARWPLGRVAFATFCATLALALGVLAG
FT                   VLGWLGLLSRSSFRSSPGTALDVVKLVLGAVAGVGALVGLVIAYRRQLVAETADDRERT
FT                   RLFNERFNAAAEQLGSDRAGVRQAGIYSMEGLADDWPAGRQKCVDVLCALARRGHVLQP
FT                   PADAPIEDRLAWDDDRQFRHAIMRVVADHLRPAAAVPWRGGNFDFTGALVDGGDFEGIE
FT                   LTGGRLVFAGARFVAGAPLVLRGSRIDGGLLDVRGAVFDSGALDLSKASVGPQATVNFS
FT                   DVLFQDGYIDIRTTTIEGCCYLCRATMSGAEIELSESSLRGTIDFRDARLAGGVMRFDG
FT                   AVVAPERFRFAGARFEGATLDFSGAQVDGLLDFGTAASPTGVMLPPTPTVAPHSAPE"
     MGQDSQNSDS LGRRRAPALA RWPLGRVAFA TFCATLALAL GVLAGVLGWL GLLSRSSFRS        60
     SPGTALDVVK LVLGAVAGVG ALVGLVIAYR RQLVAETADD RERTRLFNER FNAAAEQLGS       120
     DRAGVRQAGI YSMEGLADDW PAGRQKCVDV LCALARRGHV LQPPADAPIE DRLAWDDDRQ       180
     FRHAIMRVVA DHLRPAAAVP WRGGNFDFTG ALVDGGDFEG IELTGGRLVF AGARFVAGAP       240
     LVLRGSRIDG GLLDVRGAVF DSGALDLSKA SVGPQATVNF SDVLFQDGYI DIRTTTIEGC       300
     CYLCRATMSG AEIELSESSL RGTIDFRDAR LAGGVMRFDG AVVAPERFRF AGARFEGATL       360
     DFSGAQVDGL LDFGTAASPT GVMLPPTPTV APHSAPE                                397
//

If you have problems or comments...

PBIL Back to PBIL home page