(data stored in ACNUC7421 zone)

EMBL: CP001700.PE44

CP001700.PE44        Location/Qualifiers
FT   CDS             complement(45480..46550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0044"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ace:Acel_0013
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68999"
FT                   /db_xref="GOA:C7QFR0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU68999.1"
FT                   /translation="MPPGSPGSPSVPATELPACYRHPGREAQIRCTRCDRRICPECMVP
FT                   ASVGFQCPECVRGGNQEVRKARSPFGAVLRPRVVPVVTYSLIALNFVMFGLQHIVGTSQ
FT                   VGAAGGGVFQVNTLDMRLELIAKGTWVDGQPIGVANGEWYRLVTSMFLHANLIHIASNM
FT                   ISLFFIGPMLEAMLGRLRFVLVYLIGGLAGAVTSYWFMTPLSPASLGASGAISAVFGCL
FT                   VVIGLRRKILDPGMIAVVLVINIVIPLQNTNIDWRDHVGGVVAGALIGAVYAFAPELIG
FT                   ALGKARAPREQQVRLLNWLGFGTMALVLALAIGGTAVHTAHLNDPANRTRTVDGAVYSP
FT                   GPTRVVTDVPTSYPQA"
     MPPGSPGSPS VPATELPACY RHPGREAQIR CTRCDRRICP ECMVPASVGF QCPECVRGGN        60
     QEVRKARSPF GAVLRPRVVP VVTYSLIALN FVMFGLQHIV GTSQVGAAGG GVFQVNTLDM       120
     RLELIAKGTW VDGQPIGVAN GEWYRLVTSM FLHANLIHIA SNMISLFFIG PMLEAMLGRL       180
     RFVLVYLIGG LAGAVTSYWF MTPLSPASLG ASGAISAVFG CLVVIGLRRK ILDPGMIAVV       240
     LVINIVIPLQ NTNIDWRDHV GGVVAGALIG AVYAFAPELI GALGKARAPR EQQVRLLNWL       300
     GFGTMALVLA LAIGGTAVHT AHLNDPANRT RTVDGAVYSP GPTRVVTDVP TSYPQA           356
//

If you have problems or comments...

PBIL Back to PBIL home page