(data stored in ACNUC7421 zone)

EMBL: CP001700.PE440

CP001700.PE440       Location/Qualifiers
FT   CDS             497445..498017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69395"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX44"
FT                   /inference="similar to AA sequence:KEGG:SAV_624"
FT                   /protein_id="ACU69395.1"
FT                   /translation="MSEIPNEPASANRPFTEFLRAHGAADMPHPGGTLLAHLIRVSDRL
FT                   AEWGVPLAVQVAGLCHATYGTDGFAPSLLDLADRAILVELIGEGAEALVYRYASCDRSA
FT                   TYPRLRGGEQPVFRDRFAGADCQPTGEELRAFLDITAANELDVFRHNAELADRHAPAFY
FT                   RLLESVRALMSPAAWDAVRGDLGDRAS"
     MSEIPNEPAS ANRPFTEFLR AHGAADMPHP GGTLLAHLIR VSDRLAEWGV PLAVQVAGLC        60
     HATYGTDGFA PSLLDLADRA ILVELIGEGA EALVYRYASC DRSATYPRLR GGEQPVFRDR       120
     FAGADCQPTG EELRAFLDIT AANELDVFRH NAELADRHAP AFYRLLESVR ALMSPAAWDA       180
     VRGDLGDRAS                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page