(data stored in ACNUC7421 zone)

EMBL: CP001700.PE441

CP001700.PE441       Location/Qualifiers
FT   CDS             498312..500072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0444"
FT                   /product="Ricin B lectin"
FT                   /note="PFAM: Ricin B lectin; SMART: Ricin B lectin; KEGG:
FT                   sus:Acid_7414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69396"
FT                   /db_xref="GOA:C7PX45"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX45"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ACU69396.1"
FT                   /translation="MKISPRRLITALAALCLGIGAALGMIAAPAQAAASATSEQTFLTF
FT                   YGWWDNTPPGADIAYPQIHQTAGGTGTYADPITFATDSNEQPPGTIVYVPRVGKYFIME
FT                   DGCDECSSDWTGHGPNGGPNLRHLDLWLGGKGGNAFDAIECEDALTNYNSDGTPTMEPV
FT                   IVNPPSNETVSSSPIFNTSTGACYGGAKPTISVGQYKNVSTGNCMTDPNNSSSAGALLV
FT                   TAACDSTAASQRFTFDGTFLQINNLCADYSTSQISMQKCTAGPSQQWSYNTDLTFTDIQ
FT                   TGKKYINDSSGKVKSGSSSSSTKTWTYVPAGSGTTNDFSVAASPASASVTAGGTATATV
FT                   STAVTAGAAESVALSASGGPAGSTVSLSPTNVTSGGSSTLSVATTSTTAPGTYTITVTG
FT                   KAATGTHTATYTLTVNPVSGGGGCTAAQLLTNPGFESGASTGWTGSSTLGFNPITNSTS
FT                   GEPTHAGSWESWFNGNGSADTDTVAQSVTIPSGCTATLSYWLHIDTTESTSTAKPDTFS
FT                   VQLLNSSGTVLTTLATYSNLDKASGYTQHSSDVSAYAGQTVKLRFTGTETDKNGGTTSF
FT                   VLDDTALNAK"
     MKISPRRLIT ALAALCLGIG AALGMIAAPA QAAASATSEQ TFLTFYGWWD NTPPGADIAY        60
     PQIHQTAGGT GTYADPITFA TDSNEQPPGT IVYVPRVGKY FIMEDGCDEC SSDWTGHGPN       120
     GGPNLRHLDL WLGGKGGNAF DAIECEDALT NYNSDGTPTM EPVIVNPPSN ETVSSSPIFN       180
     TSTGACYGGA KPTISVGQYK NVSTGNCMTD PNNSSSAGAL LVTAACDSTA ASQRFTFDGT       240
     FLQINNLCAD YSTSQISMQK CTAGPSQQWS YNTDLTFTDI QTGKKYINDS SGKVKSGSSS       300
     SSTKTWTYVP AGSGTTNDFS VAASPASASV TAGGTATATV STAVTAGAAE SVALSASGGP       360
     AGSTVSLSPT NVTSGGSSTL SVATTSTTAP GTYTITVTGK AATGTHTATY TLTVNPVSGG       420
     GGCTAAQLLT NPGFESGAST GWTGSSTLGF NPITNSTSGE PTHAGSWESW FNGNGSADTD       480
     TVAQSVTIPS GCTATLSYWL HIDTTESTST AKPDTFSVQL LNSSGTVLTT LATYSNLDKA       540
     SGYTQHSSDV SAYAGQTVKL RFTGTETDKN GGTTSFVLDD TALNAK                      586
//

If you have problems or comments...

PBIL Back to PBIL home page