(data stored in ACNUC7421 zone)

EMBL: CP001700.PE442

CP001700.PE442       Location/Qualifiers
FT   CDS             500344..502587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69397"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69397.1"
FT                   /translation="MRKHTSRAARAAALCAAAAAVATFTVPAQGAVGATPQATPVPSTT
FT                   SRVTLATGDTVELSPAGTRVLPGGPSKAFTTFTDTKGDTYIVPAEAVPFAGRVLDMSLF
FT                   DVTRLAAMAQGAQGSQIPVSLAFQAGVTPSAPAGVTLTAVSGQTATGYMTPASGAALAT
FT                   ALQKQIAADKTAGRTVGSGGLLGLTSMRVAGTGTPVTPNYPMRILQINALDTDGAPLDS
FT                   YVTLINTDNSQIMAVSEPVVGGVARIALPAGNYAAYMSDFSYDTSGYITGEALVAVNDF
FT                   AVPATGDVPALTLDARTATAPVSVTTQQSSTAQNLMQQMTRTPTTGPTVVLGSFFIFTG
FT                   GMPLTMTPQATAKVGKFTLDTVEDMAGPAGAGPDNYQYQYFLDFPSDHIDADQSHHPAD
FT                   RDLAAETENIDSDPALAGAERGVDAAPVLPYTGPGLQFGAAMPQKSTSYFTPGRWANGI
FT                   SGPWASGPGQPEGPSLWSGAKTYHAGQVSQHTWGAAPSAPAFGRYQESAAEVDCQVCVG
FT                   AGNMDLEFYDAGDSNPDTVGVDFDANPSATFYWNGQPLTPPSGPPGFSSPDIIVPNVGT
FT                   TPATVRAVLDTDRTSGEKQSTNTHTDVTFQYTGKTDSRSTLPDGNYCPAAIAAGQPSAP
FT                   CQIMPVMTIGYQYGALSRTNVSQSPVQSLVLDIGHHSFGGHGSLAPVVSAKVSVSFDSG
FT                   ATWQDVPTVGAFGHYAALWHNPAPGTPVAVRVTAADSIGGSISQTVTNPYTVG"
     MRKHTSRAAR AAALCAAAAA VATFTVPAQG AVGATPQATP VPSTTSRVTL ATGDTVELSP        60
     AGTRVLPGGP SKAFTTFTDT KGDTYIVPAE AVPFAGRVLD MSLFDVTRLA AMAQGAQGSQ       120
     IPVSLAFQAG VTPSAPAGVT LTAVSGQTAT GYMTPASGAA LATALQKQIA ADKTAGRTVG       180
     SGGLLGLTSM RVAGTGTPVT PNYPMRILQI NALDTDGAPL DSYVTLINTD NSQIMAVSEP       240
     VVGGVARIAL PAGNYAAYMS DFSYDTSGYI TGEALVAVND FAVPATGDVP ALTLDARTAT       300
     APVSVTTQQS STAQNLMQQM TRTPTTGPTV VLGSFFIFTG GMPLTMTPQA TAKVGKFTLD       360
     TVEDMAGPAG AGPDNYQYQY FLDFPSDHID ADQSHHPADR DLAAETENID SDPALAGAER       420
     GVDAAPVLPY TGPGLQFGAA MPQKSTSYFT PGRWANGISG PWASGPGQPE GPSLWSGAKT       480
     YHAGQVSQHT WGAAPSAPAF GRYQESAAEV DCQVCVGAGN MDLEFYDAGD SNPDTVGVDF       540
     DANPSATFYW NGQPLTPPSG PPGFSSPDII VPNVGTTPAT VRAVLDTDRT SGEKQSTNTH       600
     TDVTFQYTGK TDSRSTLPDG NYCPAAIAAG QPSAPCQIMP VMTIGYQYGA LSRTNVSQSP       660
     VQSLVLDIGH HSFGGHGSLA PVVSAKVSVS FDSGATWQDV PTVGAFGHYA ALWHNPAPGT       720
     PVAVRVTAAD SIGGSISQTV TNPYTVG                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page