(data stored in ACNUC7421 zone)

EMBL: CP001700.PE443

CP001700.PE443       Location/Qualifiers
FT   CDS             502620..503858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0446"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: bac:BamMC406_0814 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69398"
FT                   /db_xref="GOA:C7PX47"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX47"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_0814"
FT                   /protein_id="ACU69398.1"
FT                   /translation="MKTRIRILTALAAGAAAALGLAAPAVAAPTHGGGGTKPSGGTSVA
FT                   VCAAATPGHASCFARLRTDVHGGSGVRGAAAGRSKPANAAPPTGLSPADLRAAYNLPST
FT                   GGAGQTVAIVDAGAEPNIESDLAVYRATYGLPACTTANGCFQVANQRGAASPLPPDQGW
FT                   GVEIALDVDMVSAACPQCHILLVEADDASNENLAASVDTAVALGATEVSNSYGGPEASD
FT                   SAQVASHYSHPGVAILASTGDSGYQPANAPAVYGSVIAVGGTTLTRAATSRGWSESAWS
FT                   GAGSGCSAWFAKPAWQQDANCPGRMTADVSADADPNTGPAIYCTDGCPGWGVVGGTSVS
FT                   SPFLAGVVALAGHPGRFPDASYLYAHASGLNDVVGGNNSVSGMDCGGDYQCNAVADYDG
FT                   PTGLGTPNGLAAF"
     MKTRIRILTA LAAGAAAALG LAAPAVAAPT HGGGGTKPSG GTSVAVCAAA TPGHASCFAR        60
     LRTDVHGGSG VRGAAAGRSK PANAAPPTGL SPADLRAAYN LPSTGGAGQT VAIVDAGAEP       120
     NIESDLAVYR ATYGLPACTT ANGCFQVANQ RGAASPLPPD QGWGVEIALD VDMVSAACPQ       180
     CHILLVEADD ASNENLAASV DTAVALGATE VSNSYGGPEA SDSAQVASHY SHPGVAILAS       240
     TGDSGYQPAN APAVYGSVIA VGGTTLTRAA TSRGWSESAW SGAGSGCSAW FAKPAWQQDA       300
     NCPGRMTADV SADADPNTGP AIYCTDGCPG WGVVGGTSVS SPFLAGVVAL AGHPGRFPDA       360
     SYLYAHASGL NDVVGGNNSV SGMDCGGDYQ CNAVADYDGP TGLGTPNGLA AF               412
//

If you have problems or comments...

PBIL Back to PBIL home page