(data stored in ACNUC7421 zone)

EMBL: CP001700.PE444

CP001700.PE444       Location/Qualifiers
FT   CDS             complement(503955..505037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0447"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: stp:Strop_3846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69399"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX48"
FT                   /inference="similar to AA sequence:KEGG:Strop_3846"
FT                   /protein_id="ACU69399.1"
FT                   /translation="MRHSIIRSLAVGAVAALALGACSSGTGGSAKGRKPYIGVILPDTT
FT                   SSARWATQDQPALAAAFKAKNVKYDIQNAQGNKTQFQAIADHMLKEGVNILMIVDLDAA
FT                   TGTAVLAKARQQGVPTIDYDRLTLGGGADYYVSFDNVDVGELQGQGLVACLGGTKKPVV
FT                   AEVNGSPTDNNATLFAQGYNSVLNPLYADGTFIKGPNQSTTDWKNDIAGQNFAKMLAEA
FT                   PNIGGVLVANDGMAQAVIGVLKQHHLNGRVQVTGQDATVAGLQSVLVGDQCMTIFKDSV
FT                   KEANAAAELATALATGGSASSANTMVADSVTGKLVASVMLTPEAIVKQNVGDVISAGAV
FT                   TKAQVCTPEFAEACTANGIK"
     MRHSIIRSLA VGAVAALALG ACSSGTGGSA KGRKPYIGVI LPDTTSSARW ATQDQPALAA        60
     AFKAKNVKYD IQNAQGNKTQ FQAIADHMLK EGVNILMIVD LDAATGTAVL AKARQQGVPT       120
     IDYDRLTLGG GADYYVSFDN VDVGELQGQG LVACLGGTKK PVVAEVNGSP TDNNATLFAQ       180
     GYNSVLNPLY ADGTFIKGPN QSTTDWKNDI AGQNFAKMLA EAPNIGGVLV ANDGMAQAVI       240
     GVLKQHHLNG RVQVTGQDAT VAGLQSVLVG DQCMTIFKDS VKEANAAAEL ATALATGGSA       300
     SSANTMVADS VTGKLVASVM LTPEAIVKQN VGDVISAGAV TKAQVCTPEF AEACTANGIK       360
//

If you have problems or comments...

PBIL Back to PBIL home page