(data stored in ACNUC7421 zone)

EMBL: CP001700.PE445

CP001700.PE445       Location/Qualifiers
FT   CDS             complement(505599..506447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0448"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: nca:Noca_0921 ABC transporter related;
FT                   TIGRFAM: phosphate ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69400"
FT                   /db_xref="GOA:C7PX49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX49"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACU69400.1"
FT                   /translation="MTDSDLSHAGAVAVDDRPDAAGPHLPGTLEARAVSAWFGDRKVLD
FT                   RVSLTMPGGQVTALIGPSGCGKSTFLRILNRMHELVASAALAGEVLLDGGDIYDPRVRL
FT                   TEARARIGMVFQKPNPFPGMSIYDNVTAGLKLTGTRRSRSEQDDIVESCLTRAGLWNEV
FT                   SDRLKQPGGALSGGQQQRLCIARSLAVRPEVLLMDEPCSALDPTSTNRIEETIRELASD
FT                   VTIVIVTHNMQQASRVSDRCAFFLASAGTPGRIVEHGQTRAMFSSPQDQRTSDYVNGRF
FT                   G"
     MTDSDLSHAG AVAVDDRPDA AGPHLPGTLE ARAVSAWFGD RKVLDRVSLT MPGGQVTALI        60
     GPSGCGKSTF LRILNRMHEL VASAALAGEV LLDGGDIYDP RVRLTEARAR IGMVFQKPNP       120
     FPGMSIYDNV TAGLKLTGTR RSRSEQDDIV ESCLTRAGLW NEVSDRLKQP GGALSGGQQQ       180
     RLCIARSLAV RPEVLLMDEP CSALDPTSTN RIEETIRELA SDVTIVIVTH NMQQASRVSD       240
     RCAFFLASAG TPGRIVEHGQ TRAMFSSPQD QRTSDYVNGR FG                          282
//

If you have problems or comments...

PBIL Back to PBIL home page