(data stored in ACNUC7421 zone)

EMBL: CP001700.PE446

CP001700.PE446       Location/Qualifiers
FT   CDS             complement(506478..507128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0449"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: nca:Noca_0919 peptidase C60, sortase
FT                   A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69401"
FT                   /db_xref="GOA:C7PX50"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX50"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU69401.1"
FT                   /translation="MLRAGVPVAVLAIPSVGVDEVVGEGTGAAVLESGPGLRRDTVLPG
FT                   QAGTSVIMARASGYGGPFRYLDQLQPGDRVEVTTGQGVADYRVSDVRRRGDPEPARLHG
FT                   QLGRLTLVTASGAAYTPNGALYVDADLISDVQPTPPAPVPHPGAEESAMGEDRYARPDV
FT                   AAWTAVLAGATVLAFWAGPRWGRAKTWLVAVPVLLVVGLTLADRIALLLPNLT"
     MLRAGVPVAV LAIPSVGVDE VVGEGTGAAV LESGPGLRRD TVLPGQAGTS VIMARASGYG        60
     GPFRYLDQLQ PGDRVEVTTG QGVADYRVSD VRRRGDPEPA RLHGQLGRLT LVTASGAAYT       120
     PNGALYVDAD LISDVQPTPP APVPHPGAEE SAMGEDRYAR PDVAAWTAVL AGATVLAFWA       180
     GPRWGRAKTW LVAVPVLLVV GLTLADRIAL LLPNLT                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page