(data stored in ACNUC7421 zone)

EMBL: CP001700.PE447

CP001700.PE447       Location/Qualifiers
FT   CDS             complement(507808..508311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69402"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69402.1"
FT                   /translation="MSGTTDSPARVAALTVIIVTAWLHAGSSAMADTGATSGPALGGGD
FT                   ITVSTLMAPGSLVISVPLRQPALTSKLQPITVTDNRTEDPGWTVTVILTSHETAGLTWN
FT                   PDLLSAAPGESVILGPKTGPRPSLQQPRTLASTQPGASLGTALLSAALYPSGSGAATFT
FT                   LTAI"
     MSGTTDSPAR VAALTVIIVT AWLHAGSSAM ADTGATSGPA LGGGDITVST LMAPGSLVIS        60
     VPLRQPALTS KLQPITVTDN RTEDPGWTVT VILTSHETAG LTWNPDLLSA APGESVILGP       120
     KTGPRPSLQQ PRTLASTQPG ASLGTALLSA ALYPSGSGAA TFTLTAI                     167
//

If you have problems or comments...

PBIL Back to PBIL home page