(data stored in ACNUC7421 zone)

EMBL: CP001700.PE448

CP001700.PE448       Location/Qualifiers
FT   CDS             complement(508308..509465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0451"
FT                   /product="protein of unknown function DUF916 cell surface
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF916 cell
FT                   surface putative; KEGG: saq:Sare_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69403"
FT                   /db_xref="GOA:C7PX52"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX52"
FT                   /inference="protein motif:PFAM:PF06030"
FT                   /protein_id="ACU69403.1"
FT                   /translation="MPRLRSLIKVLAATAVAGVLLTSPASAGTPPRTDPAPAPAPTAGA
FT                   ATFGIQPATATARDKTRDSFTYQATPGAKKTDYVAVSNYSTSPLTLRIYATDAYNTADG
FT                   GFTVLPLATKPRDVGLWVSFPTTGVTLAAKSSKILPFTLTVPADAKPGDHVGGIMLSLT
FT                   TQAADAKGGQIAVESRVGTRLQVRVPGTLKAQLTVSHISTSYHASSNPFGGGTMTVSYT
FT                   VANTGNVRLSGTQKVHVTSLFGGSKPSLPLANVKELLPGDQERVTATVKSVLPSFSSTA
FT                   HISVVPTPVVGDIDPVLAAVDESASVATIPWPMILLLLALGAFGGVWVWRRRVRVRVRK
FT                   QQAAKAKAKAAKTAPAKKTAVPATAAATATAGAASKAESGKAEDV"
     MPRLRSLIKV LAATAVAGVL LTSPASAGTP PRTDPAPAPA PTAGAATFGI QPATATARDK        60
     TRDSFTYQAT PGAKKTDYVA VSNYSTSPLT LRIYATDAYN TADGGFTVLP LATKPRDVGL       120
     WVSFPTTGVT LAAKSSKILP FTLTVPADAK PGDHVGGIML SLTTQAADAK GGQIAVESRV       180
     GTRLQVRVPG TLKAQLTVSH ISTSYHASSN PFGGGTMTVS YTVANTGNVR LSGTQKVHVT       240
     SLFGGSKPSL PLANVKELLP GDQERVTATV KSVLPSFSST AHISVVPTPV VGDIDPVLAA       300
     VDESASVATI PWPMILLLLA LGAFGGVWVW RRRVRVRVRK QQAAKAKAKA AKTAPAKKTA       360
     VPATAAATAT AGAASKAESG KAEDV                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page