(data stored in ACNUC7421 zone)

EMBL: CP001700.PE449

CP001700.PE449       Location/Qualifiers
FT   CDS             complement(509613..511190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0452"
FT                   /product="NHL repeat-containing protein"
FT                   /note="KEGG: sus:Acid_6846 NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69404"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX53"
FT                   /inference="similar to AA sequence:KEGG:Acid_6846"
FT                   /protein_id="ACU69404.1"
FT                   /translation="MFSNRFARYAATAVAAATAVGVMTVLSAATASAAASGTITFSPGS
FT                   GADTSVFNVETSGVCPANDTYIDATISGGGFPANAVAINKEPVSVLTATQTGYEIAISN
FT                   NLRQLATNYAVTKLDPNASGQTPYTIDVQCIPALGNTVGADFAGQLTFTSETAWSSASS
FT                   TPTTTTLGLAPTSPVSFGSQVTLTATVNPAAAGSVTFFDGATALNATPVAVANGTASYQ
FT                   TSSLAVGAHTITAAFTSTDANFANSTSAASTYTVGQAGPVATTTSLVSTPGSAQVAGGN
FT                   VDLTASVQPATAAGSVTFMDGATSLGTVAVSNGSAVFNTTALALGSHSLTASFVPTNTT
FT                   AYGSSASPAVPFTVTKYVPPTATETITTTVDAGSLNISVPTGQVSLPDPALNSNGTLFT
FT                   TSGSLETVTVTDNRAGNPGWTASGLATAFAQTGGSVQISAENLGWTPGTPTGSAGQTLT
FT                   TGPSVAPANGVAASDNGALGLSQSRTLVSAASGAGLGTAKIGATLALNVPTTTTAGTYQ
FT                   STLTLTVI"
     MFSNRFARYA ATAVAAATAV GVMTVLSAAT ASAAASGTIT FSPGSGADTS VFNVETSGVC        60
     PANDTYIDAT ISGGGFPANA VAINKEPVSV LTATQTGYEI AISNNLRQLA TNYAVTKLDP       120
     NASGQTPYTI DVQCIPALGN TVGADFAGQL TFTSETAWSS ASSTPTTTTL GLAPTSPVSF       180
     GSQVTLTATV NPAAAGSVTF FDGATALNAT PVAVANGTAS YQTSSLAVGA HTITAAFTST       240
     DANFANSTSA ASTYTVGQAG PVATTTSLVS TPGSAQVAGG NVDLTASVQP ATAAGSVTFM       300
     DGATSLGTVA VSNGSAVFNT TALALGSHSL TASFVPTNTT AYGSSASPAV PFTVTKYVPP       360
     TATETITTTV DAGSLNISVP TGQVSLPDPA LNSNGTLFTT SGSLETVTVT DNRAGNPGWT       420
     ASGLATAFAQ TGGSVQISAE NLGWTPGTPT GSAGQTLTTG PSVAPANGVA ASDNGALGLS       480
     QSRTLVSAAS GAGLGTAKIG ATLALNVPTT TTAGTYQSTL TLTVI                       525
//

If you have problems or comments...

PBIL Back to PBIL home page