(data stored in ACNUC7421 zone)

EMBL: CP001700.PE45

CP001700.PE45        Location/Qualifiers
FT   CDS             complement(46660..47241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0045"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: krh:KRH_00110 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69000"
FT                   /db_xref="GOA:C7QFR1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR1"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU69000.1"
FT                   /translation="MTETERQQTVAENLYATIKTNHGDIVVRLLPDYAPKTVANFVGLA
FT                   EGTREWTHPETNVTSTTPLYDGTIFHRIIPQFMIQGGDPLGQGFGGPGYVFDDEPHPDQ
FT                   TFNDRDYLLAMANAGIRNGKGTNGSQFFITVPTPRRPTHLNGKHTIFGEVVDADSRKVV
FT                   DEIAGVRTGAQDRPVNDVVIEKISIERREG"
     MTETERQQTV AENLYATIKT NHGDIVVRLL PDYAPKTVAN FVGLAEGTRE WTHPETNVTS        60
     TTPLYDGTIF HRIIPQFMIQ GGDPLGQGFG GPGYVFDDEP HPDQTFNDRD YLLAMANAGI       120
     RNGKGTNGSQ FFITVPTPRR PTHLNGKHTI FGEVVDADSR KVVDEIAGVR TGAQDRPVND       180
     VVIEKISIER REG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page