(data stored in ACNUC7421 zone)

EMBL: CP001700.PE450

CP001700.PE450       Location/Qualifiers
FT   CDS             complement(511249..512247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0920 ABC-type phosphate transport
FT                   system periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69405"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69405.1"
FT                   /translation="MNQKTKKLAVIGAVGLFVLGAAGSAQADPSGAPQFRQLAGVGSDT
FT                   TTPVMNALSNDLTVGGTKVIGSYDATGSTTIATQAGTTCSKIARPNGSGAGRTALLASL
FT                   AAKDGCLQFSRSSSLTLTATGGAQLTYVPFALDGVTYAITGTDTLIPRNLDLATLQSIY
FT                   TCDPTVVGTAPNFSITAMLPQAGSGTRSFWEGKMGITDADVVAGKYACITDKSNGQPIE
FT                   EQDGRVLTDKAIIPYSIASYDAEESQTIQDVRGAAVLGAVGGVAAQQINSSFPVTREVY
FT                   NVIPTADTATAPWSTTFVGSSSLVCADSSTITKFGFTVAPDCGSTTNVTAP"
     MNQKTKKLAV IGAVGLFVLG AAGSAQADPS GAPQFRQLAG VGSDTTTPVM NALSNDLTVG        60
     GTKVIGSYDA TGSTTIATQA GTTCSKIARP NGSGAGRTAL LASLAAKDGC LQFSRSSSLT       120
     LTATGGAQLT YVPFALDGVT YAITGTDTLI PRNLDLATLQ SIYTCDPTVV GTAPNFSITA       180
     MLPQAGSGTR SFWEGKMGIT DADVVAGKYA CITDKSNGQP IEEQDGRVLT DKAIIPYSIA       240
     SYDAEESQTI QDVRGAAVLG AVGGVAAQQI NSSFPVTREV YNVIPTADTA TAPWSTTFVG       300
     SSSLVCADSS TITKFGFTVA PDCGSTTNVT AP                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page