(data stored in ACNUC7421 zone)

EMBL: CP001700.PE451

CP001700.PE451       Location/Qualifiers
FT   CDS             complement(512244..515093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_0918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69406"
FT                   /db_xref="GOA:C7PX55"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69406.1"
FT                   /translation="MRTLTISRVVSGAFAVCVAVSGLLSGPTSHAAAAAAPQPTPKTNA
FT                   TQTASSPLTKTGTGAFSGMAVTVDKSQDLINEAIGISWTGAPTTLPRNNNTNFGADYLQ
FT                   IMQCWGDNPAGPDASQCEFGGTTLGGPTTRRLNNPQIPDPLLPPAVANDPNQEYEDFVP
FT                   APTAAPTSPYAPPAPVKDPSQIATSFDSSNTNEIPYARTYANGTGHVYFQLDTVRESPA
FT                   LGCGQPVADPAAPGGARIEPCWLVVVPRGTLEADGKTTVDGTNIVLQTSPLSPTNWANR
FT                   IVFPLTFQPAASACAIGANEVQIGGDEMLAEAIKSWEPGLCAHNPKAPFSFSQIGGDAA
FT                   RLQLASPSPGFQFLSKPVTSTPGTPLPSMLYAPAAISGLTISFYIQSQAVVPPPGQPPN
FT                   PPAAQNGVQLTQLNLNARLVAKLVTQSYRWGVDSSIDTPQGAASDLAKQNPRDLTQDPE
FT                   FLTLNPQFKGLSFAGGIPSIVVPFGNADAYTELWTWLKSDPAASEFLSGVADNTGKYGQ
FT                   PGYSGMVLNPNYLRTQFPIEDFPTTDPYCRPTVYQDPSHAGTRNQQSALCGLALHPYPV
FT                   TMHDGVLNATKGSLGLRVSWSPNSANVGSWGPTPPQPDGQVAILVLADAPTAARYGLPA
FT                   ARLCDDRAGVPDPLLPPGQQPSADLDAHCVAPTTDSLLKGVAAAQPSPGAPTMLVPNPI
FT                   PIDLGAYPLTTLTYAATAPSKLTKADGAHYADLLDYIASAGQIQGLDPGDLPPGYAPLP
FT                   AALAAQTAAAAKLLRTAAGVPEAAPIGSAPSSSATSRPAAIVTPHAPSTPPPPRVPVQH
FT                   PPLPKPTGPGPAVVVRGTMPASDLALSAGSTPAVPIGRIRFAVLICLLAAGASVLVGPG
FT                   LLRVARQAAAEGAVDGEPDSSGESDEPGEPDEPDSPGEPADSPEPADPEALDAPDVPAP
FT                   ESPETNPSQDPSPSKGTGQ"
     MRTLTISRVV SGAFAVCVAV SGLLSGPTSH AAAAAAPQPT PKTNATQTAS SPLTKTGTGA        60
     FSGMAVTVDK SQDLINEAIG ISWTGAPTTL PRNNNTNFGA DYLQIMQCWG DNPAGPDASQ       120
     CEFGGTTLGG PTTRRLNNPQ IPDPLLPPAV ANDPNQEYED FVPAPTAAPT SPYAPPAPVK       180
     DPSQIATSFD SSNTNEIPYA RTYANGTGHV YFQLDTVRES PALGCGQPVA DPAAPGGARI       240
     EPCWLVVVPR GTLEADGKTT VDGTNIVLQT SPLSPTNWAN RIVFPLTFQP AASACAIGAN       300
     EVQIGGDEML AEAIKSWEPG LCAHNPKAPF SFSQIGGDAA RLQLASPSPG FQFLSKPVTS       360
     TPGTPLPSML YAPAAISGLT ISFYIQSQAV VPPPGQPPNP PAAQNGVQLT QLNLNARLVA       420
     KLVTQSYRWG VDSSIDTPQG AASDLAKQNP RDLTQDPEFL TLNPQFKGLS FAGGIPSIVV       480
     PFGNADAYTE LWTWLKSDPA ASEFLSGVAD NTGKYGQPGY SGMVLNPNYL RTQFPIEDFP       540
     TTDPYCRPTV YQDPSHAGTR NQQSALCGLA LHPYPVTMHD GVLNATKGSL GLRVSWSPNS       600
     ANVGSWGPTP PQPDGQVAIL VLADAPTAAR YGLPAARLCD DRAGVPDPLL PPGQQPSADL       660
     DAHCVAPTTD SLLKGVAAAQ PSPGAPTMLV PNPIPIDLGA YPLTTLTYAA TAPSKLTKAD       720
     GAHYADLLDY IASAGQIQGL DPGDLPPGYA PLPAALAAQT AAAAKLLRTA AGVPEAAPIG       780
     SAPSSSATSR PAAIVTPHAP STPPPPRVPV QHPPLPKPTG PGPAVVVRGT MPASDLALSA       840
     GSTPAVPIGR IRFAVLICLL AAGASVLVGP GLLRVARQAA AEGAVDGEPD SSGESDEPGE       900
     PDEPDSPGEP ADSPEPADPE ALDAPDVPAP ESPETNPSQD PSPSKGTGQ                   949
//

If you have problems or comments...

PBIL Back to PBIL home page