(data stored in ACNUC7421 zone)

EMBL: CP001700.PE452

CP001700.PE452       Location/Qualifiers
FT   CDS             complement(515090..516802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0455"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="KEGG: nca:Noca_0917 phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69407"
FT                   /db_xref="GOA:C7PX56"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX56"
FT                   /inference="similar to AA sequence:KEGG:Noca_0917"
FT                   /protein_id="ACU69407.1"
FT                   /translation="MNRHHPRRRRSPRGRLLLLSAALGLSAAQLLSPPTAGATQYAPIA
FT                   GAGSTWAENAVNQWTSDVAQYGMQVSYTGSGSSDGRNQFKADPATVDFAISDIPYGSVD
FT                   NGTLDTLPDKPFAYMPVVAGGTAFMYHLDIGGHRVTNLRLDDQTIAKIFTGGITTWNDP
FT                   AIAKTNPGLTLPARQIIPVVRTDGSGTTAQLTGWMAAKYPGLWDSFCSAAGRVVSPHCG
FT                   STSFFPPAPAGSAFISQSLDSGVAGYVAQPTSEGAITYTEYSYALQSGFPVAKMLNAAG
FT                   YYTLPTASNVAVSLTQAQIDNDASDPTKYLTENLANVYGYSDPRTYPLSSYSYMIVPLS
FT                   TAPPFNTAKGVTLSAFDYYLLCQGQSTMAPLGYSPLPINLVQAGFNQIRKIPGAVVQNI
FT                   VISSCNNPTFSSSGVNTLVASAPDPPSCDKNGATQCAADGVTAVPGGGSSGGSHGGSSG
FT                   GGSGGSGGSSGGSGGGGGTSGGGTAGGVASGPSNGNPSAHPSSTSNVITVPTTPSSPPV
FT                   SLDGADAVAVPVSVGTSLGDSVGAYLAAAAATLLLTTVFGPPLVSRLRKGRRS"
     MNRHHPRRRR SPRGRLLLLS AALGLSAAQL LSPPTAGATQ YAPIAGAGST WAENAVNQWT        60
     SDVAQYGMQV SYTGSGSSDG RNQFKADPAT VDFAISDIPY GSVDNGTLDT LPDKPFAYMP       120
     VVAGGTAFMY HLDIGGHRVT NLRLDDQTIA KIFTGGITTW NDPAIAKTNP GLTLPARQII       180
     PVVRTDGSGT TAQLTGWMAA KYPGLWDSFC SAAGRVVSPH CGSTSFFPPA PAGSAFISQS       240
     LDSGVAGYVA QPTSEGAITY TEYSYALQSG FPVAKMLNAA GYYTLPTASN VAVSLTQAQI       300
     DNDASDPTKY LTENLANVYG YSDPRTYPLS SYSYMIVPLS TAPPFNTAKG VTLSAFDYYL       360
     LCQGQSTMAP LGYSPLPINL VQAGFNQIRK IPGAVVQNIV ISSCNNPTFS SSGVNTLVAS       420
     APDPPSCDKN GATQCAADGV TAVPGGGSSG GSHGGSSGGG SGGSGGSSGG SGGGGGTSGG       480
     GTAGGVASGP SNGNPSAHPS STSNVITVPT TPSSPPVSLD GADAVAVPVS VGTSLGDSVG       540
     AYLAAAAATL LLTTVFGPPL VSRLRKGRRS                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page