(data stored in ACNUC7421 zone)

EMBL: CP001700.PE453

CP001700.PE453       Location/Qualifiers
FT   CDS             complement(516799..518133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0456"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0916
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69408"
FT                   /db_xref="GOA:C7PX57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX57"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACU69408.1"
FT                   /translation="MTATDMAAADIAAADMTGLTEEPEDAGTTVPPEPAADDAGPPERR
FT                   RRVRRLKRDALFALLGAAAAAVSLTILISTWFAPFSGPLGFVVLSYPLFLACYAVLVWT
FT                   DESGPILRDRLMAVVTHSIAILVAGVLVLIVGFPIWGGLKSLTHLNFYTQDLRVAGPVQ
FT                   PITIGGLQHAVIGTAEQITITLAITVPLGIACAVFMNESPGRLANLVRTVAAAATALPS
FT                   IVAGLFVFALLILELGLPKSGLAAALALSVMTLPIIIRASDVVLRLVPGHLKEASYALG
FT                   ASRWRTALRVTLPTARSGLATAVILGAARGIGETSPVLLTAGYTQYTNYDPRKGPQTSL
FT                   PLATFKLVTSGQPNYVTRGYGAAALLMLLVLVLFVAARAVGGRGAGQLSRRQRRRRAAT
FT                   SRRVQERFLARRAAREQADPATAAAASATPAATTADRPEPMEHSS"
     MTATDMAAAD IAAADMTGLT EEPEDAGTTV PPEPAADDAG PPERRRRVRR LKRDALFALL        60
     GAAAAAVSLT ILISTWFAPF SGPLGFVVLS YPLFLACYAV LVWTDESGPI LRDRLMAVVT       120
     HSIAILVAGV LVLIVGFPIW GGLKSLTHLN FYTQDLRVAG PVQPITIGGL QHAVIGTAEQ       180
     ITITLAITVP LGIACAVFMN ESPGRLANLV RTVAAAATAL PSIVAGLFVF ALLILELGLP       240
     KSGLAAALAL SVMTLPIIIR ASDVVLRLVP GHLKEASYAL GASRWRTALR VTLPTARSGL       300
     ATAVILGAAR GIGETSPVLL TAGYTQYTNY DPRKGPQTSL PLATFKLVTS GQPNYVTRGY       360
     GAAALLMLLV LVLFVAARAV GGRGAGQLSR RQRRRRAATS RRVQERFLAR RAAREQADPA       420
     TAAAASATPA ATTADRPEPM EHSS                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page