(data stored in ACNUC7421 zone)

EMBL: CP001700.PE454

CP001700.PE454       Location/Qualifiers
FT   CDS             complement(518135..519256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0457"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: nca:Noca_0915
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69409"
FT                   /db_xref="GOA:C7PX58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX58"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACU69409.1"
FT                   /translation="MTEQFIPPAGHAQAASAAAGAAGATTAAAANALTHVVDLPPTAGA
FT                   EPPRAVRLKARGGDRVFLTVLAGSGILVLTVIAVIGGFLGSRASQALHAAGGGFLTTAA
FT                   WSPGNGTGRASSFGVAGILTGTVLIGLVAIVIAVPLAFGVALYISEYAPPRLRPFFTSL
FT                   IDLMAAVPSVVYGLWGFLFLEHRAVGVAHWLATYLGWIPGFQVTGARVHDPLAPLTVYT
FT                   ASTFIAGTVVGLMITPIVSSMMRESFSQAPLGEREGAYALGATRWGVIRTVVLPFGRGG
FT                   VIGGAMLGLGRALGETIAVYMIISLVFRIQPHILQAGASSVAALIAAHYGTATPFELSA
FT                   LMAAGLVLFLVTLVINLAASAIIARSRSGRDSG"
     MTEQFIPPAG HAQAASAAAG AAGATTAAAA NALTHVVDLP PTAGAEPPRA VRLKARGGDR        60
     VFLTVLAGSG ILVLTVIAVI GGFLGSRASQ ALHAAGGGFL TTAAWSPGNG TGRASSFGVA       120
     GILTGTVLIG LVAIVIAVPL AFGVALYISE YAPPRLRPFF TSLIDLMAAV PSVVYGLWGF       180
     LFLEHRAVGV AHWLATYLGW IPGFQVTGAR VHDPLAPLTV YTASTFIAGT VVGLMITPIV       240
     SSMMRESFSQ APLGEREGAY ALGATRWGVI RTVVLPFGRG GVIGGAMLGL GRALGETIAV       300
     YMIISLVFRI QPHILQAGAS SVAALIAAHY GTATPFELSA LMAAGLVLFL VTLVINLAAS       360
     AIIARSRSGR DSG                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page