(data stored in ACNUC7421 zone)

EMBL: CP001700.PE456

CP001700.PE456       Location/Qualifiers
FT   CDS             520055..521302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0459"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: mmi:MMAR_0696
FT                   lipoprotein, LpqK"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69411"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX60"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU69411.1"
FT                   /translation="MRTALLCAALLMSAAPLVAVPAHADAGAGARRGPGECAASPAPVS
FT                   GPAGDRARAVADAVAKVRHDLKLRSVITRVTQDGRDVWTGALGPSMTGVPARTDMRFRA
FT                   GSVGIAFMGVMLMQLVDEKRVSLADPISRWLPEVPHADQITLGMLGDSTSGIQDYVKNP
FT                   AFVAELLAHPFKQWTPQELLALANPQTPLYAPGKNFSYSHANYVLLGAALERITHTRLD
FT                   RLLQQRIYPRFGLHATANSFTPDIPAPALHAFTTARGPFEESSFWNPSWTTAPGAVITM
FT                   DVCDLARAGQGVGVGTTLTRQGHQTFLNPGTVGLGTPQPYLPGGDCPAAICIPQTAAAH
FT                   YGLGALVVNGWVFQNPSFTGYAALMAYLPSQHLTIAVSVTTSADTDPDIVNAGKNVAVA
FT                   ISQALVPSNPLTFGPF"
     MRTALLCAAL LMSAAPLVAV PAHADAGAGA RRGPGECAAS PAPVSGPAGD RARAVADAVA        60
     KVRHDLKLRS VITRVTQDGR DVWTGALGPS MTGVPARTDM RFRAGSVGIA FMGVMLMQLV       120
     DEKRVSLADP ISRWLPEVPH ADQITLGMLG DSTSGIQDYV KNPAFVAELL AHPFKQWTPQ       180
     ELLALANPQT PLYAPGKNFS YSHANYVLLG AALERITHTR LDRLLQQRIY PRFGLHATAN       240
     SFTPDIPAPA LHAFTTARGP FEESSFWNPS WTTAPGAVIT MDVCDLARAG QGVGVGTTLT       300
     RQGHQTFLNP GTVGLGTPQP YLPGGDCPAA ICIPQTAAAH YGLGALVVNG WVFQNPSFTG       360
     YAALMAYLPS QHLTIAVSVT TSADTDPDIV NAGKNVAVAI SQALVPSNPL TFGPF            415
//

If you have problems or comments...

PBIL Back to PBIL home page