(data stored in ACNUC7421 zone)

EMBL: CP001700.PE457

CP001700.PE457       Location/Qualifiers
FT   CDS             complement(521339..524392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0460"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; Fibronectin type
FT                   III domain protein; type 3a cellulose-binding domain
FT                   protein; SMART: Fibronectin type III domain protein; KEGG:
FT                   tfu:Tfu_2176 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69412"
FT                   /db_xref="GOA:C7PX61"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX61"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACU69412.1"
FT                   /translation="MRLRTPRFRITGPTATLLAGLLVANVLTLAIPTAAHAGTPSATGE
FT                   FDYAEALQDSMLFYESQRSGPLPADNRVSWRGPSDLTDGADHGLDLTGGYHDAGDEVKF
FT                   GLPEAYSMTALAWGAIDDKSGYQKSGQWQYLERDLRWGDDYIIKAHPSPHVFYGQVGDG
FT                   SSDHSFWGPAEVNPEPRPSYAVTESCPGSDLVGQASAAMAASSIVFQTDDPSYSAKLLA
FT                   QAKSLYEFADDYRGKYDACITGASSFYTSFSGYWDELVWGAIWLYKATGDTAYLTKAET
FT                   YFANLNKANQTTTPEYAWTISWDDSSYASYILLAEITGQQQYIDDAERNLDWFTTGYNG
FT                   QHVSMSPGGEAQVDVWGTARYSANEAYLALDFENWLKSQSLDTARQATYHDFAVRQMNY
FT                   ILGDNPNKESYEVGFTNGGTNTAWPQQIHNRPAHDSWDQSMSDPPNTRHLDYGLLVGGP
FT                   TSGDGFTDSRQNYQQTEGALDYNALFSGALAELTTEYGGTPRANFPPTETPDGPEELMQ
FT                   ASPNQTGSNFIEIKAEVVNKSGWPARHLTNGSFRYYFTLDAGETASQLQLTSPYSQCNA
FT                   PGPITQYSGSTYYVTISCAGDDVAPAGQSQFHREVQFRITFPAAHDYTKDWSYQDLVGM
FT                   ATNSTPVNTSHIELYDGSTKVWGTAPGSGTPVTPPGTPGTPTASAITATGATLAWAAST
FT                   PGTNAVAGYDVYSVSGATSTKVASSTTTSAPLTGLTPGTAYTFDVVARDSAGNQSPASP
FT                   TVAVTTTSSSATPPSAPTALTVTATGSTSVGLSWTAAKAGTSAIASYTVYKTGSPATAV
FT                   ATVAAPAITATVSGLTPSTVYQFYVVATDVNGLSSAASSSVSATTTAGTPPPPSSVSVQ
FT                   YETSVTTATTQSFQPLLNVVNNGTSAVPLSSVTIRYWFTSDGGSSTFATNCWYAVIGCA
FT                   KVTQSVSSVTATTGADHYVQVGFTTAAGSLAPGASTGQVQSAINKSDWSNFTQTNDYSF
FT                   NAADTAWTANTNVTVYVNGTLVWGTEPH"
     MRLRTPRFRI TGPTATLLAG LLVANVLTLA IPTAAHAGTP SATGEFDYAE ALQDSMLFYE        60
     SQRSGPLPAD NRVSWRGPSD LTDGADHGLD LTGGYHDAGD EVKFGLPEAY SMTALAWGAI       120
     DDKSGYQKSG QWQYLERDLR WGDDYIIKAH PSPHVFYGQV GDGSSDHSFW GPAEVNPEPR       180
     PSYAVTESCP GSDLVGQASA AMAASSIVFQ TDDPSYSAKL LAQAKSLYEF ADDYRGKYDA       240
     CITGASSFYT SFSGYWDELV WGAIWLYKAT GDTAYLTKAE TYFANLNKAN QTTTPEYAWT       300
     ISWDDSSYAS YILLAEITGQ QQYIDDAERN LDWFTTGYNG QHVSMSPGGE AQVDVWGTAR       360
     YSANEAYLAL DFENWLKSQS LDTARQATYH DFAVRQMNYI LGDNPNKESY EVGFTNGGTN       420
     TAWPQQIHNR PAHDSWDQSM SDPPNTRHLD YGLLVGGPTS GDGFTDSRQN YQQTEGALDY       480
     NALFSGALAE LTTEYGGTPR ANFPPTETPD GPEELMQASP NQTGSNFIEI KAEVVNKSGW       540
     PARHLTNGSF RYYFTLDAGE TASQLQLTSP YSQCNAPGPI TQYSGSTYYV TISCAGDDVA       600
     PAGQSQFHRE VQFRITFPAA HDYTKDWSYQ DLVGMATNST PVNTSHIELY DGSTKVWGTA       660
     PGSGTPVTPP GTPGTPTASA ITATGATLAW AASTPGTNAV AGYDVYSVSG ATSTKVASST       720
     TTSAPLTGLT PGTAYTFDVV ARDSAGNQSP ASPTVAVTTT SSSATPPSAP TALTVTATGS       780
     TSVGLSWTAA KAGTSAIASY TVYKTGSPAT AVATVAAPAI TATVSGLTPS TVYQFYVVAT       840
     DVNGLSSAAS SSVSATTTAG TPPPPSSVSV QYETSVTTAT TQSFQPLLNV VNNGTSAVPL       900
     SSVTIRYWFT SDGGSSTFAT NCWYAVIGCA KVTQSVSSVT ATTGADHYVQ VGFTTAAGSL       960
     APGASTGQVQ SAINKSDWSN FTQTNDYSFN AADTAWTANT NVTVYVNGTL VWGTEPH         1017
//

If you have problems or comments...

PBIL Back to PBIL home page