(data stored in ACNUC7421 zone)

EMBL: CP001700.PE458

CP001700.PE458       Location/Qualifiers
FT   CDS             524639..525700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0461"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: sco:SCO4754 transcriptional regulator; PFAM:
FT                   periplasmic binding protein/LacI transcriptional regulator;
FT                   regulatory protein LacI; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69413"
FT                   /db_xref="GOA:C7PX62"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX62"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69413.1"
FT                   /translation="MAPRRSRNGVDLTAPTTASTTTTTIAAVAEEVGVSVATVSKVLNG
FT                   RSDVAAQTRAKVEESLERHQYRRRAKKKQTGTGQVDLVFHELDSAWAMEIIRGVEAVTE
FT                   PDGVDVVLSQLGGAHHPPQHWLDAVLARRPLGVLFVLCSPTKVQQERLRRQDIPFVVVD
FT                   TDSATTASVPTVGSNNWNGGLVATRHLLELGHRRIGIISGPKDVLCSRARLAGFRAAHE
FT                   EADVEVDPDLVRYGTFYLDAGYEHGMALLDRPDRPTAVFAGSDMQALGVLRAARQLGID
FT                   VPRGLSVIGYDNLEVAAWTDPALTTIDQPIRDMAGTATRMVLDLAHGQDPSSSRIDLVT
FT                   ALVVRESTAPPAG"
     MAPRRSRNGV DLTAPTTAST TTTTIAAVAE EVGVSVATVS KVLNGRSDVA AQTRAKVEES        60
     LERHQYRRRA KKKQTGTGQV DLVFHELDSA WAMEIIRGVE AVTEPDGVDV VLSQLGGAHH       120
     PPQHWLDAVL ARRPLGVLFV LCSPTKVQQE RLRRQDIPFV VVDTDSATTA SVPTVGSNNW       180
     NGGLVATRHL LELGHRRIGI ISGPKDVLCS RARLAGFRAA HEEADVEVDP DLVRYGTFYL       240
     DAGYEHGMAL LDRPDRPTAV FAGSDMQALG VLRAARQLGI DVPRGLSVIG YDNLEVAAWT       300
     DPALTTIDQP IRDMAGTATR MVLDLAHGQD PSSSRIDLVT ALVVRESTAP PAG              353
//

If you have problems or comments...

PBIL Back to PBIL home page