(data stored in ACNUC7421 zone)

EMBL: CP001700.PE459

CP001700.PE459       Location/Qualifiers
FT   CDS             complement(525818..526831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0462"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: tfu:Tfu_1213 xylanase; PFAM: glycoside
FT                   hydrolase family 11; SMART: cellulose-binding family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69414"
FT                   /db_xref="GOA:C7PX63"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX63"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ACU69414.1"
FT                   /translation="MPGNSRLPGARRSRRLRMFIGVVLALFLGAMLPSVPASAATSICS
FT                   NQTGTNSGYYYQMWSSGQGSACISLNSGNSYSSTWSGIGDFVAGVGWNPGDKSTKSFTG
FT                   SLNANGGTSLVSLYGWSTSPLVEYYVMENYVGSPPTAGTYMGQVTSDGGTFNIYEHQQV
FT                   NQPSIQGTATFEQYLAIRTSPVSSGTITMSNYINAWSSHGMNLGTLNYQILATEAWGGG
FT                   SGSSNVSVSSGGGGGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSNWTVT
FT                   MNMASPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTISPNGQWTWPSVSCSSS"
     MPGNSRLPGA RRSRRLRMFI GVVLALFLGA MLPSVPASAA TSICSNQTGT NSGYYYQMWS        60
     SGQGSACISL NSGNSYSSTW SGIGDFVAGV GWNPGDKSTK SFTGSLNANG GTSLVSLYGW       120
     STSPLVEYYV MENYVGSPPT AGTYMGQVTS DGGTFNIYEH QQVNQPSIQG TATFEQYLAI       180
     RTSPVSSGTI TMSNYINAWS SHGMNLGTLN YQILATEAWG GGSGSSNVSV SSGGGGGGGG       240
     GGGGGGGGGG SCTATLSAGS QGSNWYNLNV AVTGSSNWTV TMNMASPAVV YNTWNVSATW       300
     PSQYVMVAKP NGSGNNFGVT ISPNGQWTWP SVSCSSS                                337
//

If you have problems or comments...

PBIL Back to PBIL home page