(data stored in ACNUC7421 zone)

EMBL: CP001700.PE46

CP001700.PE46        Location/Qualifiers
FT   CDS             47443..48078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG31952"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69001"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69001.1"
FT                   /translation="MPFSHDEPASRVERVRCAVRDRTSGAAHTVSGAAGTAQSAAVTAA
FT                   GVAQGTAHQVADRATVVGQQVADRATVVAHQVADRTTVAAAAMADRARPVAAEAASRGG
FT                   AAWQVIRYGAPQPSPLARMATVIPLATVTTAARRSRAPLALMAIGAACAVGILWWRRSR
FT                   TGPDSVWILDSDSDVEPVGRWQERDNRADADDSGMDTSRRDSPANRWP"
     MPFSHDEPAS RVERVRCAVR DRTSGAAHTV SGAAGTAQSA AVTAAGVAQG TAHQVADRAT        60
     VVGQQVADRA TVVAHQVADR TTVAAAAMAD RARPVAAEAA SRGGAAWQVI RYGAPQPSPL       120
     ARMATVIPLA TVTTAARRSR APLALMAIGA ACAVGILWWR RSRTGPDSVW ILDSDSDVEP       180
     VGRWQERDNR ADADDSGMDT SRRDSPANRW P                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page