(data stored in ACNUC7421 zone)

EMBL: CP001700.PE460

CP001700.PE460       Location/Qualifiers
FT   CDS             527220..527909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69415"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69415.1"
FT                   /translation="MPELIPRLMAPFLPEETRYRLRQHKLDIEAAEKAARILPLPGVTI
FT                   TVLHSTTGARSWRETTLVPTSTPPHMTAWWFTKGSLAWDGNLLTVTGDNDTSPHWPTAQ
FT                   GGVQPEFSADNVAQARHRPVTSGECPAAVVEIASISLRGQRPRRLYFLDEESRHLTMTP
FT                   ARGFTEDQLTTFAHHAGLTYRTYALTTGGKTTPDAMCEALFPRSARRRRVISEHSPSVE
FT                   WQWQGWP"
     MPELIPRLMA PFLPEETRYR LRQHKLDIEA AEKAARILPL PGVTITVLHS TTGARSWRET        60
     TLVPTSTPPH MTAWWFTKGS LAWDGNLLTV TGDNDTSPHW PTAQGGVQPE FSADNVAQAR       120
     HRPVTSGECP AAVVEIASIS LRGQRPRRLY FLDEESRHLT MTPARGFTED QLTTFAHHAG       180
     LTYRTYALTT GGKTTPDAMC EALFPRSARR RRVISEHSPS VEWQWQGWP                   229
//

If you have problems or comments...

PBIL Back to PBIL home page