(data stored in ACNUC7421 zone)

EMBL: CP001700.PE461

CP001700.PE461       Location/Qualifiers
FT   CDS             528026..529117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69416"
FT                   /db_xref="GOA:C7PX65"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69416.1"
FT                   /translation="MASRLFDGALINDEPILKAQLKRTWRMLLMVVSASMAVVGLVFVV
FT                   LRNHFGASSDIHNVVLEVGVNLALFGCTTLLVTVIASQQLEHQILGELNTRLNAHVKNV
FT                   GDTMNEVQSEFRKTIETFLPLFGNGRDLGLDNIFLTRTDALIDIESHLRDELKSAAVES
FT                   SRTGGPDDRDGPRARLWFVGTSLKGILEASALGFDGAGILSWAASLAAQDLLDLRVLLT
FT                   HPTFARVRARQEHRAGTAIPEEISEALEFLHAHQVNAACIRMTQASPTVFAIATRERML
FT                   LNPYPYGAEAHRSFSIIVKRVHQEPNDHDSLHRDIFEQYEQRHFVRPWDDGLPVEQGAK
FT                   EDPFVIPEATFNPLRPDGGDPAA"
     MASRLFDGAL INDEPILKAQ LKRTWRMLLM VVSASMAVVG LVFVVLRNHF GASSDIHNVV        60
     LEVGVNLALF GCTTLLVTVI ASQQLEHQIL GELNTRLNAH VKNVGDTMNE VQSEFRKTIE       120
     TFLPLFGNGR DLGLDNIFLT RTDALIDIES HLRDELKSAA VESSRTGGPD DRDGPRARLW       180
     FVGTSLKGIL EASALGFDGA GILSWAASLA AQDLLDLRVL LTHPTFARVR ARQEHRAGTA       240
     IPEEISEALE FLHAHQVNAA CIRMTQASPT VFAIATRERM LLNPYPYGAE AHRSFSIIVK       300
     RVHQEPNDHD SLHRDIFEQY EQRHFVRPWD DGLPVEQGAK EDPFVIPEAT FNPLRPDGGD       360
     PAA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page