(data stored in ACNUC7421 zone)

EMBL: CP001700.PE462

CP001700.PE462       Location/Qualifiers
FT   CDS             529167..529403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69417.1"
FT                   /translation="MASDQWESDQPNVVLRGGPLDGETLTVKKLRDGIEREVDGWIYAY
FT                   VPTSDPDDEHPACTVFIYVGERPAVWLAGGLAG"
     MASDQWESDQ PNVVLRGGPL DGETLTVKKL RDGIEREVDG WIYAYVPTSD PDDEHPACTV        60
     FIYVGERPAV WLAGGLAG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page