(data stored in ACNUC7421 zone)

EMBL: CP001700.PE464

CP001700.PE464       Location/Qualifiers
FT   CDS             complement(530033..531388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0467"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ace:Acel_1594 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69419"
FT                   /db_xref="GOA:C7PX68"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX68"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69419.1"
FT                   /translation="MNLRTRLAVAGGSIVAGALVLVSVVLYPAVDTSLRGQIDKALATA
FT                   AAQAPDVAAYIKSQNAPPDGQTPAAPLFPPISMGIGTTKLQIIPSDVVRIGPSAQFIDV
FT                   SAHDVSVALGGTGPYFQDATYNGVAYRVYTMPFPDSRGSLVRTAIPESDPAPTLHELAW
FT                   LLAASTVAAGLLAALAARLAARRVLRPVGRLTETVELIRATGDLTIPIPAASRDEIGRL
FT                   GAAFSAMTSALDESVGAQRRLVADASHELRTPLTSLTVNLELLAENPSDAQAPLLAAEA
FT                   LGQAGELKALVNDLVDLARFGQAAFHTEDVRLDLVAERVAARAARRAPRIDFELRCAPT
FT                   WVHGDPDALERAFANLVDNAVKWSPAGGRVRISVVKGVVEIADDGPGIPDSDLDFVFDR
FT                   FYRSPAARAHPGSGLGLAIVRQVAETHGGTARAVRCSTGALLRLTLPVSGEA"
     MNLRTRLAVA GGSIVAGALV LVSVVLYPAV DTSLRGQIDK ALATAAAQAP DVAAYIKSQN        60
     APPDGQTPAA PLFPPISMGI GTTKLQIIPS DVVRIGPSAQ FIDVSAHDVS VALGGTGPYF       120
     QDATYNGVAY RVYTMPFPDS RGSLVRTAIP ESDPAPTLHE LAWLLAASTV AAGLLAALAA       180
     RLAARRVLRP VGRLTETVEL IRATGDLTIP IPAASRDEIG RLGAAFSAMT SALDESVGAQ       240
     RRLVADASHE LRTPLTSLTV NLELLAENPS DAQAPLLAAE ALGQAGELKA LVNDLVDLAR       300
     FGQAAFHTED VRLDLVAERV AARAARRAPR IDFELRCAPT WVHGDPDALE RAFANLVDNA       360
     VKWSPAGGRV RISVVKGVVE IADDGPGIPD SDLDFVFDRF YRSPAARAHP GSGLGLAIVR       420
     QVAETHGGTA RAVRCSTGAL LRLTLPVSGE A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page