(data stored in ACNUC7421 zone)

EMBL: CP001700.PE465

CP001700.PE465       Location/Qualifiers
FT   CDS             complement(531385..532056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0468"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: cur:cur_0545 two-component system response
FT                   regulator MprA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69420"
FT                   /db_xref="GOA:C7PX69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX69"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69420.1"
FT                   /translation="MRILVVDDDPAVRRSLEHALRRDGYDVVSVADGTSALAEHVAFRP
FT                   DAVVLDILMPEPNGLEVCRALRSAGDDTPILMLTARDLVTDRVAGLDAGADDYLAKPFA
FT                   LEELRARLRALLRRSGAQSEVLTFADVRLDLSGWRVERGGRRLELTKTELSLLELFLRN
FT                   PQHVLSRTQIFESVWGYDFGPQSNALWVYISYLRGKLEADGGARLIQTVRGLGYVLREE
FT                   P"
     MRILVVDDDP AVRRSLEHAL RRDGYDVVSV ADGTSALAEH VAFRPDAVVL DILMPEPNGL        60
     EVCRALRSAG DDTPILMLTA RDLVTDRVAG LDAGADDYLA KPFALEELRA RLRALLRRSG       120
     AQSEVLTFAD VRLDLSGWRV ERGGRRLELT KTELSLLELF LRNPQHVLSR TQIFESVWGY       180
     DFGPQSNALW VYISYLRGKL EADGGARLIQ TVRGLGYVLR EEP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page