(data stored in ACNUC7421 zone)

EMBL: CP001700.PE466

CP001700.PE466       Location/Qualifiers
FT   CDS             complement(532141..532827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpl:lp_0373 cell surface protein precursor
FT                   (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69421"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69421.1"
FT                   /translation="MVKRKRVVAVVVAIAALGATGTASAATSGNTPAPSPTKSGAPAVA
FT                   GNDTSVDKSAGKSDGKSDGKSADAGKDEFAALAAKLGVTTDRLNAAMVAAKMSLASTNG
FT                   GTPQAFYAAIAANLGLPVARVQDALGTEIFRKGPEGGKPSKHGVPGPSPFTTDSAAAFV
FT                   AHELGVDQKKAKTALAAVVALDDARGGVDPTSKAFGDIAASLGVSSSRLATALTDLKMS
FT                   IGGTKG"
     MVKRKRVVAV VVAIAALGAT GTASAATSGN TPAPSPTKSG APAVAGNDTS VDKSAGKSDG        60
     KSDGKSADAG KDEFAALAAK LGVTTDRLNA AMVAAKMSLA STNGGTPQAF YAAIAANLGL       120
     PVARVQDALG TEIFRKGPEG GKPSKHGVPG PSPFTTDSAA AFVAHELGVD QKKAKTALAA       180
     VVALDDARGG VDPTSKAFGD IAASLGVSSS RLATALTDLK MSIGGTKG                    228
//

If you have problems or comments...

PBIL Back to PBIL home page