(data stored in ACNUC7421 zone)

EMBL: CP001700.PE467

CP001700.PE467       Location/Qualifiers
FT   CDS             complement(532923..533627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0470"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: fra:Francci3_2444 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69422"
FT                   /db_xref="GOA:C7PX71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX71"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69422.1"
FT                   /translation="MRVLVVEDVRRLADDIGEGLRDQGMAVDIAYDGLTASEKCASTDY
FT                   DVVVLDRDLPGLHGDVLCRQIAESANPALVLMLTAAGSPGERVQGLRLGADDYLPKPFH
FT                   FPELVLRVQALARRRPAARPRVLRAAGIELDPTLRTATRLGRPLRLSPKEFEVLAALLA
FT                   AAPAPMSAEHLLEKVWDENADPFTRTVSVTVGRLRRKLGAPDVVVTIAGAGYGIGVSGD
FT                   EDGSSGAVLREL"
     MRVLVVEDVR RLADDIGEGL RDQGMAVDIA YDGLTASEKC ASTDYDVVVL DRDLPGLHGD        60
     VLCRQIAESA NPALVLMLTA AGSPGERVQG LRLGADDYLP KPFHFPELVL RVQALARRRP       120
     AARPRVLRAA GIELDPTLRT ATRLGRPLRL SPKEFEVLAA LLAAAPAPMS AEHLLEKVWD       180
     ENADPFTRTV SVTVGRLRRK LGAPDVVVTI AGAGYGIGVS GDEDGSSGAV LREL             234
//

If you have problems or comments...

PBIL Back to PBIL home page