(data stored in ACNUC7421 zone)

EMBL: CP001700.PE468

CP001700.PE468       Location/Qualifiers
FT   CDS             complement(533624..534736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0471"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   fra:Francci3_2445 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69423"
FT                   /db_xref="GOA:C7PX72"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX72"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69423.1"
FT                   /translation="MRLTLLYAALFLASGIVLLAVALYLVFRNPILVTFDPTPPSLPSP
FT                   MPGRSDVLRVFRPATGTVSPTWATVRAAAAQSAGVLAAMAAVSTLLGWIVAGRVLSPLR
FT                   TMAFRTRRISEQNLHERLALTGPRDEMTELATTIDGLLGRLEAAFEAQRRFIANASHEL
FT                   RTPLAMMRTSLDVAVAKPGRPREVDVLGGKLREGLDAADRLLEGLLLLARTQNVERMET
FT                   SAVSLPDLLDAALHARRATIEDKRLLVEQKVEPVLYRGNDTLLASLVDNLVDNAIRHNE
FT                   PGGWLRAQVTVPRGEHDRTRIIVENGGPLLTRAEVDLLGQPFQRLGSQRTSQPGTGLGL
FT                   SIIAAIAEVHHGRLLLQARDEGGLRAEVEL"
     MRLTLLYAAL FLASGIVLLA VALYLVFRNP ILVTFDPTPP SLPSPMPGRS DVLRVFRPAT        60
     GTVSPTWATV RAAAAQSAGV LAAMAAVSTL LGWIVAGRVL SPLRTMAFRT RRISEQNLHE       120
     RLALTGPRDE MTELATTIDG LLGRLEAAFE AQRRFIANAS HELRTPLAMM RTSLDVAVAK       180
     PGRPREVDVL GGKLREGLDA ADRLLEGLLL LARTQNVERM ETSAVSLPDL LDAALHARRA       240
     TIEDKRLLVE QKVEPVLYRG NDTLLASLVD NLVDNAIRHN EPGGWLRAQV TVPRGEHDRT       300
     RIIVENGGPL LTRAEVDLLG QPFQRLGSQR TSQPGTGLGL SIIAAIAEVH HGRLLLQARD       360
     EGGLRAEVEL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page