(data stored in ACNUC7421 zone)

EMBL: CP001700.PE469

CP001700.PE469       Location/Qualifiers
FT   CDS             534855..536432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0472"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; TAP domain
FT                   protein; KEGG: sco:SCO7650 secreted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69424"
FT                   /db_xref="GOA:C7PX73"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX73"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69424.1"
FT                   /translation="MKLSKRNGVAALGLALGVAGVGLSGTASATPDAASQASAISAITW
FT                   QACPQYSDDVLGAVGIQPKDRAAFRDMWARTDCGTVSVPQDYRHPEGQHVTIAFTRLKA
FT                   KDQAHRQGILFMNPGGPGGSGYLMPEQVALQNPSDAQLNDQYDLIGFDPRGIGYSTSED
FT                   CAGFLNGPPPQSGQLTKAQVKQAYDASAKTNAECSSSDPAFLGQLTTANAARDLDQLRR
FT                   ALHESQASYFGVSWGTQLGAVYRSMFPATIHRMWLDSVVSPRAYDLAYRMDGAAQSVEQ
FT                   DFGLFATWLAQHDDVYGLGTTAQSVTARVLALRKQGDAHPWQFSDLSEPLDGGFIASLA
FT                   SSQNTDWEQAAAVLKSMTAAVSGQPAPPGVKAVANGHGPLPPPPSGAPQAFNPTAQQAY
FT                   LCNEDDSSRAFEPLWDEYQRNLQRDPVTGDLTALRPTCAGWNLPVQHFTLRYSPGSLQM
FT                   SGHEYETLTPYPWVWQMQQAIGGTVFTVDDFRHGSLALVPECASHLIAYFETGKADSGS
FT                   CPGLQPSA"
     MKLSKRNGVA ALGLALGVAG VGLSGTASAT PDAASQASAI SAITWQACPQ YSDDVLGAVG        60
     IQPKDRAAFR DMWARTDCGT VSVPQDYRHP EGQHVTIAFT RLKAKDQAHR QGILFMNPGG       120
     PGGSGYLMPE QVALQNPSDA QLNDQYDLIG FDPRGIGYST SEDCAGFLNG PPPQSGQLTK       180
     AQVKQAYDAS AKTNAECSSS DPAFLGQLTT ANAARDLDQL RRALHESQAS YFGVSWGTQL       240
     GAVYRSMFPA TIHRMWLDSV VSPRAYDLAY RMDGAAQSVE QDFGLFATWL AQHDDVYGLG       300
     TTAQSVTARV LALRKQGDAH PWQFSDLSEP LDGGFIASLA SSQNTDWEQA AAVLKSMTAA       360
     VSGQPAPPGV KAVANGHGPL PPPPSGAPQA FNPTAQQAYL CNEDDSSRAF EPLWDEYQRN       420
     LQRDPVTGDL TALRPTCAGW NLPVQHFTLR YSPGSLQMSG HEYETLTPYP WVWQMQQAIG       480
     GTVFTVDDFR HGSLALVPEC ASHLIAYFET GKADSGSCPG LQPSA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page