(data stored in ACNUC7421 zone)

EMBL: CP001700.PE47

CP001700.PE47        Location/Qualifiers
FT   CDS             complement(48321..49223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3551 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69002"
FT                   /db_xref="GOA:C7QFR3"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69002.1"
FT                   /translation="MPPPNPARDRGSATIYAALLTGLLTTLTGAILALGTAILARHRAG
FT                   SAADLAALSAATHATPGQIPCDWARRVTTAHHTRLLHCTCNGPTCLVTTAINTPWGAAT
FT                   VTSRAGPADDPTGETTAGQNALRAEGTRLAEAAMGLRAAALSDPVGERIAGIERTRLGE
FT                   ATGGSLRTAAMTSRTHDPVGERTVEVERSSRAKPQATAPRAANLVGRTGLTHGLVGPSL
FT                   VGIERSTYAEAYPFGKRASGIAARLTTPAVASRPRPSPHRAPVVPAAPLVGVRLAVAES
FT                   EPLAGSSAASCCQLGAALP"
     MPPPNPARDR GSATIYAALL TGLLTTLTGA ILALGTAILA RHRAGSAADL AALSAATHAT        60
     PGQIPCDWAR RVTTAHHTRL LHCTCNGPTC LVTTAINTPW GAATVTSRAG PADDPTGETT       120
     AGQNALRAEG TRLAEAAMGL RAAALSDPVG ERIAGIERTR LGEATGGSLR TAAMTSRTHD       180
     PVGERTVEVE RSSRAKPQAT APRAANLVGR TGLTHGLVGP SLVGIERSTY AEAYPFGKRA       240
     SGIAARLTTP AVASRPRPSP HRAPVVPAAP LVGVRLAVAE SEPLAGSSAA SCCQLGAALP       300
//

If you have problems or comments...

PBIL Back to PBIL home page