(data stored in ACNUC7421 zone)

EMBL: CP001700.PE470

CP001700.PE470       Location/Qualifiers
FT   CDS             536641..538062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_1931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69425"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX74"
FT                   /inference="similar to AA sequence:KEGG:SAV_1931"
FT                   /protein_id="ACU69425.1"
FT                   /translation="MAESRRGVVTGRPYLTPEERVKRGRSARRDAPRSSHGEWEPAPDR
FT                   RPVIDQLEAQASTSVADLVPIRYGRMIESPFRFYRGAASIMAADLASTPRSEMRAQLCG
FT                   DAHLLNFRLLGSPERRLVFDINDFDETLRGPWEWDVKRLAASLAIAGRENGFDDHQREI
FT                   VVRTMAGGYREAMRAFAGMTSLDVWYAHGSTERIRELYTDQLDAQRRKNFRRMLEKAKG
FT                   RDSLQAAEKLTTTVDGRPRIVADPPLVVPLADLLPDLERGEVEAWIRDLVRRYSRSLRS
FT                   DLRMLLDQYRVVDMARKVVGVGSVGTRCWIVLLAGSDEQDPLFLQIKEANRSVLADYAG
FT                   ESPYAHQGHRVVAGQRLMQAVGDILLGWKRGEDAHGGSHDFYVRQLRDWKGILESRTMV
FT                   PHSMRIFGELCGATLARAHARSSDRIAIASYLGKGDGFDRALARFAEVYADQNERDHQA
FT                   LVEAVDRGRIRAQAA"
     MAESRRGVVT GRPYLTPEER VKRGRSARRD APRSSHGEWE PAPDRRPVID QLEAQASTSV        60
     ADLVPIRYGR MIESPFRFYR GAASIMAADL ASTPRSEMRA QLCGDAHLLN FRLLGSPERR       120
     LVFDINDFDE TLRGPWEWDV KRLAASLAIA GRENGFDDHQ REIVVRTMAG GYREAMRAFA       180
     GMTSLDVWYA HGSTERIREL YTDQLDAQRR KNFRRMLEKA KGRDSLQAAE KLTTTVDGRP       240
     RIVADPPLVV PLADLLPDLE RGEVEAWIRD LVRRYSRSLR SDLRMLLDQY RVVDMARKVV       300
     GVGSVGTRCW IVLLAGSDEQ DPLFLQIKEA NRSVLADYAG ESPYAHQGHR VVAGQRLMQA       360
     VGDILLGWKR GEDAHGGSHD FYVRQLRDWK GILESRTMVP HSMRIFGELC GATLARAHAR       420
     SSDRIAIASY LGKGDGFDRA LARFAEVYAD QNERDHQALV EAVDRGRIRA QAA              473
//

If you have problems or comments...

PBIL Back to PBIL home page