(data stored in ACNUC7421 zone)

EMBL: CP001700.PE471

CP001700.PE471       Location/Qualifiers
FT   CDS             complement(538153..539637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0474"
FT                   /product="glycoside hydrolase family 11"
FT                   /note="PFAM: glycoside hydrolase family 11; Ig family
FT                   protein; cellulose-binding family II; SMART:
FT                   cellulose-binding family II; Dystroglycan- type cadherin
FT                   domain protein; KEGG: sde:Sde_3061 xylanase/chitin
FT                   deacetylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69426"
FT                   /db_xref="GOA:C7PX75"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX75"
FT                   /inference="protein motif:PFAM:PF00457"
FT                   /protein_id="ACU69426.1"
FT                   /translation="MLAGVMALLPGTAGAATTICSSQTNTVSGYWYSFWTEGSGSACMT
FT                   FGSAGNYSTSWSNAGNFVAGLGWSTGGRKTVSYSGSFNPSGNGYLSLYGWTTNPLVEYY
FT                   ITDSWGSYRPTGTYKGTVTSDGGTYDIYETTRYNEPSIIGTATFNQYWAVRQSKRVGGT
FT                   ITTGNFFDAWASHGMNMGQYNYMILATEGYQSSGNSNITIGGSVTNTVTVTNPGSQSTT
FT                   AGSPASVQVHASDSASGQTLAYTASGLPPGLSINSGSGLISGTPTTPGSYQVTVTGTDT
FT                   TGAKGSATFTWTVGSETGTLVTVTSPGNQTGSVGTAISPIQIQATDSAGQALTYSATGL
FT                   PAGLSISSSGVISGTPTAAGTSDVTVTASDSSGSGSATFTWSISGGGTTTGVCHATYAR
FT                   TSEWPGGFTANVTIANTGTTAVNGWTLGWSFPGDQKITNAWSATATQSGSNVTATNVAY
FT                   NGSIAPGGTTSFGFQGTYGSNDSSPTAFTLNGTACS"
     MLAGVMALLP GTAGAATTIC SSQTNTVSGY WYSFWTEGSG SACMTFGSAG NYSTSWSNAG        60
     NFVAGLGWST GGRKTVSYSG SFNPSGNGYL SLYGWTTNPL VEYYITDSWG SYRPTGTYKG       120
     TVTSDGGTYD IYETTRYNEP SIIGTATFNQ YWAVRQSKRV GGTITTGNFF DAWASHGMNM       180
     GQYNYMILAT EGYQSSGNSN ITIGGSVTNT VTVTNPGSQS TTAGSPASVQ VHASDSASGQ       240
     TLAYTASGLP PGLSINSGSG LISGTPTTPG SYQVTVTGTD TTGAKGSATF TWTVGSETGT       300
     LVTVTSPGNQ TGSVGTAISP IQIQATDSAG QALTYSATGL PAGLSISSSG VISGTPTAAG       360
     TSDVTVTASD SSGSGSATFT WSISGGGTTT GVCHATYART SEWPGGFTAN VTIANTGTTA       420
     VNGWTLGWSF PGDQKITNAW SATATQSGSN VTATNVAYNG SIAPGGTTSF GFQGTYGSND       480
     SSPTAFTLNG TACS                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page