(data stored in ACNUC7421 zone)

EMBL: CP001700.PE472

CP001700.PE472       Location/Qualifiers
FT   CDS             540297..541307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0475"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; SMART:
FT                   cellulose-binding family II; KEGG: sco:SCO2291 secreted
FT                   acetylxylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69427"
FT                   /db_xref="GOA:C7PX76"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX76"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACU69427.1"
FT                   /translation="MRIRPRSWRRSLTSGLAAAALALAGALTVGVGAPVAHAATCGGYV
FT                   GLSFDDGPSNDHTPAILNALKQNGLRATMFNEGQYAAAYPAQVQAEINAGMWVGNHSYT
FT                   HPHLIQESQAQIDSEVSRTQQAIAAAGGGTPTLFRPPYGETNSTLRAVEAKYGLTEIIW
FT                   DIDSQDWNGASVSAIVAANGRLTNGQVILMHEWPANTLAAIPQIAQVLASHNLCPGMIS
FT                   PQTGRAVAPTGGSGGGGGGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSTWTVTM
FT                   NMVSPAVVYNTWNVSATWPSQYVMVAKPNGSGNNFGVTITPNGQWTWPSVSCSTT"
     MRIRPRSWRR SLTSGLAAAA LALAGALTVG VGAPVAHAAT CGGYVGLSFD DGPSNDHTPA        60
     ILNALKQNGL RATMFNEGQY AAAYPAQVQA EINAGMWVGN HSYTHPHLIQ ESQAQIDSEV       120
     SRTQQAIAAA GGGTPTLFRP PYGETNSTLR AVEAKYGLTE IIWDIDSQDW NGASVSAIVA       180
     ANGRLTNGQV ILMHEWPANT LAAIPQIAQV LASHNLCPGM ISPQTGRAVA PTGGSGGGGG       240
     GGGGGGGGGS CTATLSAGSQ GSNWYNLNVA VTGSSTWTVT MNMVSPAVVY NTWNVSATWP       300
     SQYVMVAKPN GSGNNFGVTI TPNGQWTWPS VSCSTT                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page