(data stored in ACNUC7421 zone)

EMBL: CP001700.PE473

CP001700.PE473       Location/Qualifiers
FT   CDS             541555..542346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69428"
FT                   /db_xref="GOA:C7PX77"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX77"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6463"
FT                   /protein_id="ACU69428.1"
FT                   /translation="MSSPDTVIAALRSEYDLLAQQVAAFSDDDLAGPSAASEWDISEVL
FT                   SHLGSGAEINRATLQAALDGTAPGGREFNESVWDRWNAMSGRERADGFVAANRELTELY
FT                   ESLDAETRENLRIDMGFLPAPIDVATAGRMRLNELAMHSWDIRVASDVNATLAPQAVRE
FT                   LLHGEPDLTAWTSKPEHLDGESLVLHVTTSEPESDFALNLTTPVSTSFEVADKYDGTLT
FT                   LPAEAWLRLKVGRLAPQHTPTGIVTTGAADLDLLRKVFPGY"
     MSSPDTVIAA LRSEYDLLAQ QVAAFSDDDL AGPSAASEWD ISEVLSHLGS GAEINRATLQ        60
     AALDGTAPGG REFNESVWDR WNAMSGRERA DGFVAANREL TELYESLDAE TRENLRIDMG       120
     FLPAPIDVAT AGRMRLNELA MHSWDIRVAS DVNATLAPQA VRELLHGEPD LTAWTSKPEH       180
     LDGESLVLHV TTSEPESDFA LNLTTPVSTS FEVADKYDGT LTLPAEAWLR LKVGRLAPQH       240
     TPTGIVTTGA ADLDLLRKVF PGY                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page