(data stored in ACNUC7421 zone)

EMBL: CP001700.PE474

CP001700.PE474       Location/Qualifiers
FT   CDS             542651..543949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0477"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cms:CMS_0868 putative solute-binding transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69429"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX78"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69429.1"
FT                   /translation="MTTRMRSAIAVFLGLGTMLAATGCAGSSGGGGGGSSDGKVTVTVW
FT                   ENATNGPDGLQYFQSAAKQYQALHPNVTISFQTIQNEALDGKLQTALNSNSAPDVFFQV
FT                   GGGKMRAQVAAGELQPLNLTDADKTDVGAAALSGSTLDGKVYMMPVDTQPEGIYYSKNL
FT                   FQQAGITTTPTTIDELEADVAKLKAINVAPIAVGAKDAWPAAHWYYNFALRECSQSVMA
FT                   STAKSLKFTDPCWTTAGNALATFLKTNPFPAGFLTTAAQQGAGSSAGLLANHKAAMELM
FT                   GSWDPGVIASLTPDQKPLPDLGWFPFPAVAGGQGDPSAIMGGNSAYSLSKKAPKEAFGF
FT                   LEFMLTKDQQEAYSKAFQSIPVNPASQDVVTTSYNISALQAFNKAAYSMQYLDTQFGLN
FT                   VGNALNTAVVNLMAGRGSAAEIVTQANAAAAKG"
     MTTRMRSAIA VFLGLGTMLA ATGCAGSSGG GGGGSSDGKV TVTVWENATN GPDGLQYFQS        60
     AAKQYQALHP NVTISFQTIQ NEALDGKLQT ALNSNSAPDV FFQVGGGKMR AQVAAGELQP       120
     LNLTDADKTD VGAAALSGST LDGKVYMMPV DTQPEGIYYS KNLFQQAGIT TTPTTIDELE       180
     ADVAKLKAIN VAPIAVGAKD AWPAAHWYYN FALRECSQSV MASTAKSLKF TDPCWTTAGN       240
     ALATFLKTNP FPAGFLTTAA QQGAGSSAGL LANHKAAMEL MGSWDPGVIA SLTPDQKPLP       300
     DLGWFPFPAV AGGQGDPSAI MGGNSAYSLS KKAPKEAFGF LEFMLTKDQQ EAYSKAFQSI       360
     PVNPASQDVV TTSYNISALQ AFNKAAYSMQ YLDTQFGLNV GNALNTAVVN LMAGRGSAAE       420
     IVTQANAAAA KG                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page