(data stored in ACNUC7421 zone)

EMBL: CP001700.PE475

CP001700.PE475       Location/Qualifiers
FT   CDS             complement(544071..545078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0478"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bsu:BSU07300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69430"
FT                   /db_xref="GOA:C7PX79"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX79"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69430.1"
FT                   /translation="MKVSIIMATYDKRDYLEYTLASLAGQTHSDFELVLCDDGTEGGVA
FT                   DLIAPYRDRFAIVPLVQANAGRAAARNTALARASGDLVVFSDDDRILPPEFLAAHVSAH
FT                   SAGGEEDLAVIGWKKRGVTVWIPRMLPVDESDLTTLARRVGGVEPLASPLRTIEPGDVA
FT                   VSYPVAVSRMELGDEPDNYHAIVDKYGDELADFRFGWVLATTANLSVPRALLDKIGGFD
FT                   DGFQGWGVEDTDLSYRLWQAGTRFRIERAAVNHHQVHPIGTGNALLDNRRRRAALMANV
FT                   EFFCRKHQTLEAYLFKRRWEHAMTLDEANRLLAEVEAGVGHSVREELLRLYAAA"
     MKVSIIMATY DKRDYLEYTL ASLAGQTHSD FELVLCDDGT EGGVADLIAP YRDRFAIVPL        60
     VQANAGRAAA RNTALARASG DLVVFSDDDR ILPPEFLAAH VSAHSAGGEE DLAVIGWKKR       120
     GVTVWIPRML PVDESDLTTL ARRVGGVEPL ASPLRTIEPG DVAVSYPVAV SRMELGDEPD       180
     NYHAIVDKYG DELADFRFGW VLATTANLSV PRALLDKIGG FDDGFQGWGV EDTDLSYRLW       240
     QAGTRFRIER AAVNHHQVHP IGTGNALLDN RRRRAALMAN VEFFCRKHQT LEAYLFKRRW       300
     EHAMTLDEAN RLLAEVEAGV GHSVREELLR LYAAA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page