(data stored in ACNUC7421 zone)

EMBL: CP001700.PE476

CP001700.PE476       Location/Qualifiers
FT   CDS             complement(545134..546588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0479"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: amr:AM1_E0096
FT                   cytochrome P450 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69431"
FT                   /db_xref="GOA:C7PX80"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX80"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU69431.1"
FT                   /translation="MTEIAERPPVPVPVPVPGPEPARLLGRRLNRQRYFKDPVGYTCAV
FT                   YHRFGPVSGLTHGDRQHFFAFGAEQNRTVLLDDGTFHTAFEYATPPMIKAARRGIGLLN
FT                   MNGPPHQAARRLVAPAFRASAVRGYGEAVALITRAEVDSWSQGDRFDLSVRMRELTLRI
FT                   VCLVLFGVDIAEDARPLGRLVQRMLALRYFAPSIRYFPFNVPGAPLARLLGVIRDLDDA
FT                   LDGIVATRRDGGGRDLLSGLMEARAEDGGPALSADELIGHLTTFIVAGHETTSNTLSWA
FT                   FAILDQHPDIADALTGEVGALPEDVESRLAEIDKLPLLDAVVKEVLRLMPPGPNTSRVA
FT                   VAPTELGGFEIPPGSQVVTSKFVTHRDESLFPDPLRFHPDRWATQGPVSVYQYLPFGVG
FT                   PHVCVGAAFATLEMKIILAEVLRRWSPRVADGADLSRDVGLMMAPKNGVSVILRPPGTP
FT                   RAGGRVVGDIHQMVRLTDRDIDRLGW"
     MTEIAERPPV PVPVPVPGPE PARLLGRRLN RQRYFKDPVG YTCAVYHRFG PVSGLTHGDR        60
     QHFFAFGAEQ NRTVLLDDGT FHTAFEYATP PMIKAARRGI GLLNMNGPPH QAARRLVAPA       120
     FRASAVRGYG EAVALITRAE VDSWSQGDRF DLSVRMRELT LRIVCLVLFG VDIAEDARPL       180
     GRLVQRMLAL RYFAPSIRYF PFNVPGAPLA RLLGVIRDLD DALDGIVATR RDGGGRDLLS       240
     GLMEARAEDG GPALSADELI GHLTTFIVAG HETTSNTLSW AFAILDQHPD IADALTGEVG       300
     ALPEDVESRL AEIDKLPLLD AVVKEVLRLM PPGPNTSRVA VAPTELGGFE IPPGSQVVTS       360
     KFVTHRDESL FPDPLRFHPD RWATQGPVSV YQYLPFGVGP HVCVGAAFAT LEMKIILAEV       420
     LRRWSPRVAD GADLSRDVGL MMAPKNGVSV ILRPPGTPRA GGRVVGDIHQ MVRLTDRDID       480
     RLGW                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page