(data stored in ACNUC7421 zone)

EMBL: CP001700.PE477

CP001700.PE477       Location/Qualifiers
FT   CDS             complement(546640..547785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69432"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX81"
FT                   /inference="similar to AA sequence:KEGG:SGR_588"
FT                   /protein_id="ACU69432.1"
FT                   /translation="MIRDGALVLSAAVMTHPDREAEVRRFVERHPELELRIAVDPEPER
FT                   GHSLGTALLAWSMVEPGATHHLVLQDDVVLCEGFVDLMVAAVRTHPDAAVSMFAEWGAR
FT                   AGTLVRLALLRGQGYAAVADPYIPTQALVLPAAQAADFAEKGRTETEPDDIALLNHLRR
FT                   TGTRGVVVAPNLVQHQDRPSLTGNTFQGPRLSACFVPDPPAGLLAALEPTVAGADLDFL
FT                   PHVSWMRLIGEWFYCGPDEEAVWTGWPLAERLPPELDAAWLRSQYDAHLRQSDRREEIR
FT                   KTLSDTVLFEVWLACLALGLVSGVTPAGVVARAADPLWQAALATVLPGAFRRYLPAPVL
FT                   DRLGPYAAELFGLAIHEGATVAAGGEQDTVHAIAHRGARWP"
     MIRDGALVLS AAVMTHPDRE AEVRRFVERH PELELRIAVD PEPERGHSLG TALLAWSMVE        60
     PGATHHLVLQ DDVVLCEGFV DLMVAAVRTH PDAAVSMFAE WGARAGTLVR LALLRGQGYA       120
     AVADPYIPTQ ALVLPAAQAA DFAEKGRTET EPDDIALLNH LRRTGTRGVV VAPNLVQHQD       180
     RPSLTGNTFQ GPRLSACFVP DPPAGLLAAL EPTVAGADLD FLPHVSWMRL IGEWFYCGPD       240
     EEAVWTGWPL AERLPPELDA AWLRSQYDAH LRQSDRREEI RKTLSDTVLF EVWLACLALG       300
     LVSGVTPAGV VARAADPLWQ AALATVLPGA FRRYLPAPVL DRLGPYAAEL FGLAIHEGAT       360
     VAAGGEQDTV HAIAHRGARW P                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page