(data stored in ACNUC7421 zone)

EMBL: CP001700.PE478

CP001700.PE478       Location/Qualifiers
FT   CDS             complement(547782..549041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0481"
FT                   /product="glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   lxx:Lxx06832 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69433"
FT                   /db_xref="GOA:C7PX82"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX82"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACU69433.1"
FT                   /translation="MTLFESPRLRVLFVAFSRSSLGHIVRSTTAAARFAADGHDVAVAC
FT                   HEEVRHIPEKAGLAWLPIEEIGPAPAWRGMDDPEQLRAFVRTRLASPEYVSASLEDELR
FT                   VIDLFRPDVVIADMRNTAGVAASMRGVTAFTLHNLRLFQHPMHVVLPEVLVTLDQLGVE
FT                   QAHARHVLGSTVLVPDIAEIDGLSDVPRDTAALICSLTDEIRHLGPLLSPELLSVAARA
FT                   SESESGPGPRATENRRRLLHVTLGGSGVGDQQIRRVVEAVAGLGLDIGVTLGAESLQDQ
FT                   VTALEDELAAVAGDSAVTVTGFRHDVVERVAAADAAVVHGGHGSIIEALVCGTPLVFLP
FT                   GSLEQRENARKIRELGLGVVLAPDDDAAAVRAKVVKALSLKETPGPRRFARALVAADGA
FT                   GRLVDYVTSSQAIRTAVAAP"
     MTLFESPRLR VLFVAFSRSS LGHIVRSTTA AARFAADGHD VAVACHEEVR HIPEKAGLAW        60
     LPIEEIGPAP AWRGMDDPEQ LRAFVRTRLA SPEYVSASLE DELRVIDLFR PDVVIADMRN       120
     TAGVAASMRG VTAFTLHNLR LFQHPMHVVL PEVLVTLDQL GVEQAHARHV LGSTVLVPDI       180
     AEIDGLSDVP RDTAALICSL TDEIRHLGPL LSPELLSVAA RASESESGPG PRATENRRRL       240
     LHVTLGGSGV GDQQIRRVVE AVAGLGLDIG VTLGAESLQD QVTALEDELA AVAGDSAVTV       300
     TGFRHDVVER VAAADAAVVH GGHGSIIEAL VCGTPLVFLP GSLEQRENAR KIRELGLGVV       360
     LAPDDDAAAV RAKVVKALSL KETPGPRRFA RALVAADGAG RLVDYVTSSQ AIRTAVAAP        419
//

If you have problems or comments...

PBIL Back to PBIL home page